KEGG   Carnobacterium sp. 17-4: CAR_c06910Help
Entry
CAR_c06910        CDS       T01452                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:crn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709889..710521
Genome map
AA seq 210 aa AA seqDB search
MNGENNMYEYIKGIVTFVSPAYIVLETNGIGYQLFIANPFRFSSKLNEEITIYVHQAVRE
DAITLYGFKDYTEKQLYLKLLSVSGIGPKSGLAILANDNHQGLVQAIENEDAAYLTKFPG
VGKKTASQIVLDLKGKLADLTVAPLENAADYQQELVLSTNYNHVTEAMEALEALGYSAKE
IKKIEPQIRKLNKESTDAYLREALRLLMKK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggagaaaataatatgtatgaatatattaaagggatagtgacctttgttagtcct
gcgtacattgtccttgaaacaaatgggatagggtaccaattatttatagctaaccctttt
cgcttttcaagtaaattaaatgaggaaataacaatttatgtacaccaagctgttcgagaa
gatgcgattacgttatatggttttaaagattatactgaaaaacaattgtatttaaaattg
cttagcgtttcaggtattggtccaaaaagtggattagctattttagctaatgataatcat
caaggtctagtacaagcaattgaaaatgaagacgcagcttatttaacaaaatttccagga
gtgggtaaaaaaacggcatcacagatcgttttggatctaaaagggaaattagctgacttg
acagttgcaccattagaaaatgcagctgattatcaacaggaattagtattgtccactaat
tacaatcatgttactgaagcaatggaagctctagaagcgttagggtacagtgcgaaagaa
attaaaaaaattgaaccgcaaattcgtaaattaaataaagaatcaacagatgcttattta
cgagaagctttgcgattattgatgaagaagtaa

DBGET integrated database retrieval system