KEGG   Carnobacterium sp. 17-4: CAR_c06980Help
Entry
CAR_c06980        CDS       T01452                                 

Gene name
adhE
Definition
bifunctional alcohol dehydrogenase/acetaldehyde dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CAR_c06980 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c06980 (adhE)
   00620 Pyruvate metabolism
    CAR_c06980 (adhE)
   00650 Butanoate metabolism
    CAR_c06980 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    CAR_c06980 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CAR_c06980 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CAR_c06980 (adhE)
   00626 Naphthalene degradation
    CAR_c06980 (adhE)
Enzymes [BR:crn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CAR_c06980 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CAR_c06980 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
716024..718651
Genome map
AA seq 875 aa AA seqDB search
MEVGMKEKIKTDKKSAVSNNVSVVDAIDNLVNRGKEALSVLETFDQEKVDFIVHQMAMAG
LSQHMPLAKMAVEETGRGIYEDKCIKNMFATESIWNSIKDNKTVGIISKDNQTELIEVAT
PVGVVCGVTPVTNPTSTTMFKALIALKTRNPIIFSFHPSAQKCSIAAATVLKEAAIKAGA
PENCIQWIEQPSLEATNNLMQHPGVAIVLATGGSAMVKSAYSTGKPALGVGPGNVPSYIE
KSAKIKRAVNDIIASKTFDNGMICASEQAVIVDKEIYQEVKEEFKKHSIYFAKPNEIEKF
EKAVMNEAKVAVNPEIVGQAPYKIAALAGIEIPHETKMIVVEINGVGADYPLSREKLSPV
LAMIKADSTRHAFDLSQQMLELGGLGHSAAIHTQNDALAEKFGVEMKACRILVNSPTAQG
GIGDLYNNMIPSLTLGCGSYGKNSISKNVTAVNLMNVKTIAKRRNNMQWFKLPAKIYFEK
NSLAYLQDMENIERVFLVCDPGMVKFGYADTVVQELMKRTNKVQIEIFSDVEPNPSTDTV
KAGTEAMVRFQPDTIIAIGGGSAMDAAKGMWLFYEKPETIFFGAKQKFLDIRKRTYKIPN
LTKTQFVCIPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPDVAIIDPQFVMSVPKSV
TADTGMDVLTHAIESYVSVMASDYTRGLSLQAIKLVFENLRASYEYGTEEAREKMHNAST
MAGMAFANAFLGINHSIAHKIGAAYDIPHGRTNAILLPHVVRYNAKDPAKHALFPKYEYF
HAHEDYAEIARFLGFKGNTTEELVESLVQEINKLGKDVGIDMSLKGQGVTSENLYNTVDE
LAELAFEDQCTTANPKQPLISELKQIIIDAFEEVH
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggaagttggtatgaaagaaaaaatcaaaacagataaaaaaagtgctgtaagtaataat
gttagtgtagttgatgcaatcgacaacttagttaaccgagggaaagaagcattaagtgtt
ttagaaacatttgatcaagaaaaagttgattttatcgttcatcaaatggcaatggctggt
ttaagccaacatatgcctttggctaaaatggcagttgaagaaacaggtagaggaatctat
gaagataaatgcattaaaaatatgtttgctacagaatctatttggaattctataaaagac
aataaaacagttgggatcattagtaaagataatcaaactgaactgatagaagtagccaca
ccagtcggagtagtatgtggtgtaacacctgttactaatccaacatctacaacaatgttt
aaagctttaattgctttaaaaacacggaacccaattattttctcttttcatccaagtgca
caaaaatgttctatagctgcagcaactgttttgaaagaagcggctataaaagctggagca
ccagaaaactgtattcaatggatcgagcaaccttcattggaagctacgaataacttgatg
caacatccgggagttgcgattgtgttagcaactggaggatctgcgatggttaaatcagct
tattctactggcaaaccagctttaggagtaggaccagggaatgtcccaagttacattgaa
aaatctgcaaaaatcaaacgtgcagttaatgatattattgcatcaaaaacatttgataat
ggaatgatttgtgcttcagaacaagcagttattgtagataaagaaatttatcaagaagta
aaagaggagtttaaaaaacattctatttattttgctaaaccaaacgaaatagaaaaattt
gaaaaagctgttatgaatgaagcaaaagttgctgtaaacccagaaatagtagggcaagct
ccttacaaaattgcagcactcgcaggtatagaaatacctcatgaaacgaaaatgattgta
gtagaaataaatggagttggcgcagattatccgttatctcgcgaaaaattatctccagta
cttgcaatgatcaaagcagattctactcgtcatgcatttgatttatctcaacaaatgtta
gaattgggcggattaggtcattcagcagcgatccatactcaaaatgatgcactagcagaa
aaatttggagtagaaatgaaagcttgtcgtattttggtgaactctccaacagctcaaggt
ggaataggtgatttatacaacaacatgattccttcattgacactaggttgcggatcatat
ggaaaaaattcaatctctaaaaatgttacggcagtaaacttaatgaatgttaaaacaatt
gcgaaacggagaaataatatgcagtggtttaaattaccagcaaaaatttattttgagaaa
aattctcttgcttatttacaagacatggaaaatatcgaacgtgtttttctagtctgtgat
cctggcatggtaaaatttggttatgcagatacagttgtacaagagttaatgaagcgaact
aacaaagttcaaattgaaattttttcagatgttgaaccaaatccttctactgacacagtt
aaagctggaacagaagctatggttcgttttcaaccagatacgattatcgctattggtggc
ggttctgcgatggatgctgctaaaggaatgtggttgttctatgaaaaacctgagacgatt
ttctttggagctaaacagaagtttttagatattcgaaaaagaacttacaaaattccgaat
ctaacaaaaacacagtttgtttgtattccaacaacttctggtacgggatctgaagtgacg
ccatttgcagtaattacagatagtgaaacacacgtgaaatacccattggctgattatgct
ctaacaccagatgtagcaatcatcgatccacagtttgttatgagtgtaccaaaatcggta
acagcggatacaggtatggatgttttgacacatgcaatcgaatcatatgtttctgtgatg
gctagtgattacactagagggttgagtcttcaagcaatcaagcttgtttttgaaaattta
cgtgcatcatacgaatatggtacagaagaagctcgagaaaaaatgcataatgcttctact
atggctgggatggcatttgctaatgcatttttaggtatcaatcattctattgcacataaa
attggagctgcttatgatattcctcatggacgcactaatgcgatattgctgcctcatgtt
gttcgttacaatgcaaaagatccagcaaaacatgctttgtttccaaaatatgaatatttc
catgcacatgaagattatgctgaaatcgcacgtttcttaggattcaaagggaatactaca
gaagaattagtggaatctttggttcaagaaattaataaattaggaaaagatgttggcatt
gatatgagtttgaaaggtcaaggtgtaacgtctgagaatttatacaacacagttgacgaa
ttggcagaattagcatttgaagatcaatgtaccacagctaatccaaaacaacccttaatc
agtgaattgaaacaaattattattgatgcatttgaagaagtacattaa

DBGET integrated database retrieval system