KEGG   Carnobacterium sp. 17-4: CAR_c07270Help
Entry
CAR_c07270        CDS       T01452                                 

Gene name
ytpS
Definition
putative DNA translocase stage III sporulation protein
Orthology
K03466  
DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
crn  Carnobacterium sp. 17-4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
747813..750860
Genome map
AA seq 1015 aa AA seqDB search
MPKYDGPSYEKNQDRQKKFKFPFYRDAENATNKEESLKTSHLKNKDSQPTKQAIKKEEKR
SRIDFTTFQKDNNSVRNYLSTIGKEEQQKQNELKKQKKQVEKRIKQTTYSKESLKHIATP
FQEGRSSTPFKVQKIPSPYYGFQERSNKKSEETNYTTILLELEKKPEDFLLFEEHLLNES
NQSFVHTEEEQEVETIQEAEALPEVEVIQEVEALQEADVLPEADVLPEADVLPEADVLPE
ADVLPEADVLPEADVLPEADVLPEADVLPEAEALPEAEALPEAEALPEVEVLQAVETIQE
VEALPEVEILQAVETIQEVEVVSEAEVIQETEVIQEVEITQEVSDENIEATTSSSESTVV
ESSLNSTKKKRGLSRSLAGMIEEEQNVRLNRGKNVARYFGEGEALPKKAKHSIKSTRISG
KPKVQSSEEIENMELMAALSRMNYLDKQTFPTNDLKQTEKLEQSQEIIETQPETQPETQP
ETQPETQPETQPETQPETTLIDSIEKNNSSNNLEESNQDEIENTVEMNSEITAPSLEMTE
EIYDENYMFPSVDLLLRPVKLEPNAIDDWVLEQAEILNETLDAFNIHAQVIGWTIGPAVT
QFELQLGRGVKVNKITNLSDDLKLSLAAKDIRIEAPIPGKSSVGIEIPNKKSRPVMLSEV
MESKEFKESHSPLTVALGVNIAGEAVVSTIDKMPHGLIAGATGSGKSVFINSLLVSLLYK
ATPSEVRLILIDPKAVELAPYNEIPHLLSPVISEPKAASEALKWAVNEMEERYQKLAAAG
VRNIQRFNEKAEEHNDFGLKMPYIVIVIDELADLMMVASSDVQDSIARITQKARAAGIHL
IVATQRPSVDVITGTIKNNIPTRVAFMVSSQVDSRTILDTGGAEKLLGRGDMLFQENGSG
RPIRVQGTYVEKEIERIVRHVKDQRPARYLFEPESLMAKLESVEGKDELFEDVLPFIVSE
GQISASALQRKFKIGFNRAANLIESLENENFISGNKGSKPREVFLTKADYEEKFL
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatatgatggacctagttatgaaaaaaatcaagatcgccaaaaaaaattcaaa
ttccctttctatcgtgatgctgaaaacgcaacgaataaggaagagtctcttaaaacttcc
catttaaaaaataaggatagtcaaccaactaaacaagcaataaaaaaagaagaaaaacgt
tctaggattgattttacaacatttcaaaaagacaataattctgttagaaattacctttca
actattgggaaagaggaacaacaaaagcaaaatgaattaaagaaacagaaaaaacaagtt
gagaaaagaattaaacaaacgacttattcaaaagaatcgttaaaacatatagctacacca
tttcaagaagggagaagttcgactccttttaaagttcaaaagattccttctccttattat
ggctttcaagagagatccaataagaaaagtgaagaaaccaattacacaactattctttta
gaattagaaaagaaaccagaagatttcttgctatttgaagagcatttattgaacgaatca
aaccagtcttttgtacatacagaagaggaacaagaagtagaaacaatacaagaagcagaa
gcacttccggaagtagaagtgatacaagaagtagaagcacttcaagaagcagacgtacta
ccagaagcagacgtactaccagaagcagacgtactaccagaagcagacgtactaccagaa
gcagacgtactaccagaagcagacgtactaccagaagcagacgtactaccagaagcagac
gtactaccagaagcagacgtactaccagaagcagaagcactaccagaagcagaagcacta
ccagaagcagaagcactaccagaagtagaagtactacaagcagtagaaacgatacaagaa
gtagaagcactaccagaagtagaaatactacaagcagtagaaacgatacaagaagtagaa
gtagtatcagaagcagaagtaattcaagaaacagaggtaatacaagaagtagaaataaca
caagaagtatctgatgaaaatatagaagctactactagtagttctgaatcaacggttgtt
gagagctcgttaaattctacaaagaaaaaacgtgggttatctcgttctttagctggcatg
atcgaggaagagcaaaatgttcgacttaatcgcgggaaaaatgtagcaaggtattttggt
gaaggggaagccttaccaaaaaaagcaaaacattctattaaatcaacccggatttctggc
aaacctaaagttcaaagttctgaagaaatagaaaatatggaacttatggcagcactaagt
cgaatgaattatctagataaacaaacatttccaactaatgatttaaaacaaactgaaaaa
ctagaacaatctcaagaaatcattgaaacacaaccagaaacacaaccagaaacacaacca
gaaacacaaccagaaacacaaccagaaacacaaccagaaacacaaccagaaacaactctt
atcgattccattgaaaaaaataattctagcaacaatttagaagagtcaaaccaagatgaa
atagaaaatactgtagagatgaacagtgaaatcaccgctccatcattggaaatgactgaa
gaaatatatgatgaaaattatatgttcccatcagtagatcttttgcttcgtcctgtaaaa
cttgaaccaaatgcaattgacgattgggttttagaacaagcagaaatattaaatgagaca
ttagatgcttttaatatccatgctcaagtaattggttggacgattggcccagcagtcact
caatttgagcttcagttaggtcgtggcgtaaaagttaacaaaattacgaacctatctgat
gatttaaaactttcgctagcggcaaaggatattcgtatagaagctcctattcctgggaaa
agttcagtaggtattgaaattccgaataaaaagtctagacctgtgatgctatcggaagtt
atggaaagtaaagaatttaaagagagccattctcctttaacagttgcacttggggttaat
atagcaggagaagcagttgtttctactattgataaaatgcctcatggtttgattgcggga
gcaacaggttcaggaaaaagtgtctttattaattctcttttagtgagtctattatacaaa
gctacaccaagcgaagttaggttgattttaattgatccaaaagcagttgagctagctcct
tataatgaaattccacatttactttctcctgttatttctgaacctaaagcagcaagcgaa
gctttaaaatgggcagtaaatgaaatggaagaacgttaccaaaaattagcagctgcagga
gttcgaaatatccaacgctttaatgaaaaagcagaagaacataatgatttcggattgaaa
atgccttatattgtaatcgtcatcgatgaattagccgatttaatgatggtggccagtagc
gatgtgcaagattctattgcaagaattacgcaaaaagctagagcagcaggtatccactta
attgtggctacacaacgtccaagtgtagacgttattactggaacaataaaaaacaatatt
ccaactagagtagcctttatggtatctagtcaggtagactcgcggacaattttagataca
ggtggagctgaaaaacttcttggtagaggggatatgctattccaagaaaatggatcaggt
cgtccaatacgtgttcaaggaacgtatgttgaaaaagaaatagaacgaattgttagacat
gtaaaagatcaacgacctgcaaggtatctttttgagccagagtcattgatggctaaatta
gaatcagtagaaggaaaagatgaattatttgaagacgttcttccgtttattgtttctgag
gggcaaatatcagcgtcagcacttcaacggaaatttaaaataggatttaatcgagcagct
aatttgattgaatccttagaaaacgaaaattttatatcaggaaataaaggttctaaacca
cgtgaggtatttttgactaaagctgattatgaagaaaaatttctataa

DBGET integrated database retrieval system