KEGG   Carnobacterium sp. 17-4: CAR_c07450Help
Entry
CAR_c07450        CDS       T01452                                 

Gene name
trpS
Definition
tryptophanyl-tRNA synthetase (EC:6.1.1.2)
Orthology
K01867  
tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:crn00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    CAR_c07450 (trpS)
Enzymes [BR:crn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     CAR_c07450 (trpS)
Amino acid related enzymes [BR:crn01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   CAR_c07450 (trpS)
Transfer RNA biogenesis [BR:crn03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CAR_c07450 (trpS)
 Prokaryotic Type
    CAR_c07450 (trpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(772772..773776)
Genome map
AA seq 334 aa AA seqDB search
MKTIFSGIQPSGTPTIGNYIGAMKQFIDLQESYTSYFCIVDEHAITVQQEPLKLRQQTKS
LAALYLAIGLDPKKATIFIQSEVSAHAEAAWIVQCNTSLGELERMTQFKDKSAKNNRAGV
SAGLLTYPPLMVADIILYQSDLVPVGDDQKQHLELTRDFVIRFNNKYGNGNQLLTIPEVN
IPESGGRIMSLQDPLKKMSKSDENKKSFISMLDEPAIIRKKIKSAVTDSSGVIEYDPKNK
PGISNLLTIYASFTKFSVAELVDRYQNSGYGQFKEDLGEAIVSVLEPIQNRHDELIHSDE
LDSILDGGAIKAGTVANKTLLKMRNAIGLGRKRK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaattttttcaggtatccagcctagtggaactcctactattggaaactacatt
ggagcaatgaaacagtttatagatttacaagaaagttatacgagttacttttgtatcgtg
gatgaacatgcgattactgtacaacaagaaccgttgaaacttagacaacaaacgaaaagt
cttgctgcattatacttagctatcggactagatccaaaaaaagcaactatttttattcaa
tctgaagtctctgcacacgctgaagctgcttggattgtccaatgcaataccagtttaggt
gaattagaacggatgactcaatttaaagataaatccgcaaaaaataatcgtgctggcgta
tctgctggtttattgacttatcctcctctaatggtagccgatattattctttaccaatct
gatttagttcctgttggggatgaccaaaaacaacatttagaattaaccagagattttgtt
attcgatttaacaataaatacggtaatggcaatcaattgcttaccattccagaagtaaac
ataccagaatctggtggacggattatgagtttacaagatcccttgaaaaaaatgagtaag
tctgatgagaataaaaaaagttttatttcaatgttagatgaacccgcaatcattcgcaaa
aaaatcaagagtgctgtaacagattcaagtggtgtgattgagtatgatcctaaaaataaa
cctggtatttctaatttgttaaccatctatgcttcgtttactaagttcagtgttgctgaa
ttagtagatcgttatcaaaatagtgggtatggtcaatttaaggaagacttaggagaagcc
attgtttcagtattggaacctattcaaaatagacatgatgaattgatccattcagatgag
ttagactctattttagatggtggtgcaattaaagcaggcactgtagctaataaaacactt
ttgaaaatgagaaatgctattggtttaggtagaaaacgaaaatag

DBGET integrated database retrieval system