KEGG   Carnobacterium sp. 17-4: CAR_c07990Help
Entry
CAR_c07990        CDS       T01452                                 

Gene name
murE2
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:crn00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:crn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
825680..827158
Genome map
AA seq 492 aa AA seqDB search
MKAIELIKPLKSKKFSIDFSDSLEITKVTQDTREVEPGSLFVCIIGSLHNGHELAKEAVQ
KGAVLVVASEPLDVEVPVVYVNNTMKAMAILAAAFYDYPSQNLRVIGVTGTNGKTTVTHL
LDYIFHDHKEKTGVIGTMYRRIGAEVYETKNTTPDSLTLQKTLREMQENGVQTCSMEVSS
HSLVQGRVWGTDFDIAIFTNLSQDHLEYHHTMEKYAEAKSLLFSQLGNGYQQDKPKFAIL
NFDDPVGRSFEEKTAASVFSYGIDQSADFKATDLRITNKGTRFNLNFEDQVYEVQLQLVG
KFNVSNALAAIAGAYAAGLELPSVIQSLSQISGVRGRFEIVKGEYDFAVIVDYAHTPDGL
LNVLNAVNEIKTGNVFCVVGCGGDRDRTKRPIMAEIAQKNSDTVIFTSDNPRTEDPNAIL
NEVVAGLEEESYQLIPDRREAIQSAIKQAAPNDIVLIAGKGHENYQIIGTEKIHFDDVEE
AEKAIHIKNNDK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcaatcgaattaatcaaaccattaaaatcaaagaagttttcaatagatttttct
gatagtttagaaattacaaaagttactcaagatacgagagaagttgaaccgggttcactt
tttgtctgtattattggttctcttcataatggacatgaattagcgaaagaggctgttcaa
aaaggagcagttctagtggtggcaagcgaaccactagatgtagaagttccggttgtctat
gtaaacaatacaatgaaagctatggcaattttagccgctgctttttatgattatccgagc
cagaatttacgtgttataggtgttactggtacaaacggtaaaacaacggttactcatcta
ttggattatatcttccatgatcacaaagaaaaaactggagttatcggaacaatgtatcgt
cgtattggtgctgaagtttacgaaacaaaaaatacgacaccagatagtcttacgttgcaa
aaaacattgcgtgaaatgcaagaaaacggcgtacagacttgttctatggaagtctcttca
cattctttggttcaaggcagggtgtgggggactgattttgacattgcaatttttactaat
ctaagtcaagatcatctggaatatcatcacactatggaaaaatatgctgaagccaaaagt
ttattattttcacaattaggtaatggctatcagcaagataagcctaaatttgctatctta
aattttgatgatccagtgggcagaagctttgaagaaaaaacggctgcttctgttttttct
tatggaatcgatcaatcagctgattttaaggctactgatttaaggattacaaataaaggt
acccgttttaatttgaattttgaagatcaagtatacgaagtacaattacaactagttggt
aagtttaatgtgtcgaatgctttagcagctattgcaggagcatatgcggctggattggaa
ttgccttctgttatccaatcccttagccagataagtggtgtacgaggtcgttttgagatc
gttaaaggggaatatgattttgctgtaatcgttgattacgcgcacacaccagatgggtta
ttaaatgtattaaatgcagtaaatgaaattaaaactggaaatgtgttttgtgtagtcggt
tgtggcggagaccgtgatcgcactaagcgaccgataatggctgaaattgcacaaaagaat
tcagatacagtcatctttacatctgacaatccaagaacggaagatcctaatgctatatta
aatgaagtagttgcaggattagaagaagagtcttatcaattgattcctgatagaagagaa
gctatccagtctgctattaaacaggcagcacccaatgatattgtcttgattgctggaaaa
gggcatgaaaattaccaaattattggtactgaaaaaattcattttgatgatgttgaagag
gctgaaaaagcaatacacataaaaaacaatgataaatag

DBGET integrated database retrieval system