KEGG   Carnobacterium sp. 17-4: CAR_c08650Help
Entry
CAR_c08650        CDS       T01452                                 

Gene name
yrrC
Definition
putative exonuclease with DNA/RNA helicase motif protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:crn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CAR_c08650 (yrrC)
Enzymes [BR:crn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CAR_c08650 (yrrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892704..895193
Genome map
AA seq 829 aa AA seqDB search
MVMQDNLDLFAGEPPYFVGQVAAIFYQNPTNFYKVLLIRVVDTNSSFKEKEIVITGNFGQ
IQEDETYRFFGQLIEHPKFGMQFNAERYRQEKPTSAEGVVAYLSSDKFPGIGKKTAETIV
DLLGEDAIDQINADETVLAKVPGLNDKKKEVIVNTIRSSNGMEKIIIGLNDFGFGSRLAY
TIYQTYQAETLEIIQENPYKLIEDIENIGFKKADAIAENLGFAADSPRRIQAAISFALNE
LCISEGNTYTLAEPLMNETIRVLEESRSFIIEPDIVAKELLNLIEENKLIEDQHKLYINS
LYAAEWGIANSVKRLMENSKKIQYPAHNVQKEIRKMEKRLGIQYGNSQIEAIEEAVVSPL
FILTGGPGTGKTTVLNGIVTLFAELNGLSLEIDDYHDKIFPILLAAPTGRAAKRMNESTG
LPSSTIHRLLGLNGQEKPSAELSDRELEGGLLIVDEMSMVDTWLANQLLRAVPQNMQVIF
VGDKDQLPSVGPGQVLHDLIRAKQIPSRELTEIYRQDDGSSIISLAHAIKEGQLPADFTK
NKKDRSFFQCTTYQIEPVIRQVVEKAKEKGFTAQDIQVLAPMYRGPAGIDALNKMMQEIF
NPNPSGRRKEVKFNDKNYRIGDKVLQLVNYPEMNVFNGDMGEIVGINLAKETDDKVDEIV
IQFDANEVVYKRNEWMKITLAYCCSIHKSQGSEFKMVILPMVQNYHRMLRRDLLYTGITR
SSELLILCGEPNAFEECVAKSSATRLTTLTERLLGEDQHVELVVKMPANKDELKETEISD
SISTLSSATENKTETINKEEPKNYRLTIEMIQSNAIDPMIGMDGIVPSI
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
gtggttatgcaagacaatttagatttatttgcaggagagcctccctattttgtagggcaa
gtggctgcaattttctatcaaaacccgacgaatttttacaaagtattattaatacgagtt
gttgatacaaatagttctttcaaagaaaaagagatcgtcatcactggaaactttgggcaa
atccaagaagatgaaacgtatcgtttttttggtcaattaattgaacaccctaaatttggg
atgcaatttaatgcggaacgttatcgacaagaaaaaccaacttcggccgaaggggtcgtc
gcttatctctctagtgataagtttccaggaataggaaaaaaaactgcggaaacgattgtt
gatcttttgggcgaagatgcaattgatcaaattaatgcagatgaaactgttttagctaaa
gttcccgggttaaatgacaaaaagaaagaagtcatcgttaacacgatacgttccagtaac
ggaatggaaaaaattattattggattaaatgattttgggtttggaagtcgattagcatac
acgatctatcaaacttatcaagcagaaacattagagatcattcaagagaatccgtataaa
ttaatagaagatattgaaaatatcggattcaaaaaagcagatgccattgctgaaaattta
ggttttgctgcagactctcctagacgtattcaagcagctatatcatttgcattaaatgag
ttgtgtatcagtgaaggcaatacgtatactttagcagaacctttaatgaatgaaaccata
agagtacttgaagaaagtcgttcattcattattgaaccagatatagtagcaaaagaatta
ttaaacttgatcgaagaaaataaattgattgaagatcagcacaagttgtacattaattcg
ttatatgctgctgagtggggaattgcaaactctgtaaaacggttaatggaaaatagtaaa
aaaattcagtatccagcgcataatgtccaaaaagaaattcgtaaaatggaaaaaagattg
ggtattcagtatggaaattcacaaatcgaagcaattgaagaagcggtagtctcgccattg
tttattctgaccgggggaccgggaaccgggaaaacaacggtattaaatgggattgtaacc
ttgtttgctgaattaaatggcttgtctttagaaatagatgattaccacgataagatcttt
ccgattctattggccgcacctacaggacgtgcagctaaacgaatgaatgaatctacggga
ttgccaagcagtacgattcatcgtcttttaggtttaaatggccaagaaaagccaagtgcg
gaactttccgatagagaactagaaggcggattattgatcgttgatgaaatgtcaatggtg
gatacgtggctagcgaatcaattgttaagagcagtcccacaaaatatgcaagtcatcttt
gtgggagataaagatcaattgccttctgtgggccctggtcaagtattacacgaccttatt
cgtgcaaaacagattcctagtagagagttaactgaaatttaccgacaagacgatgggtct
tcgattatttcattagcacatgccattaaagaaggtcaactcccagcggattttacgaaa
aacaaaaaagaccgttctttctttcaatgcactacctatcaaattgaaccggttattcgt
caagtagtagagaaagctaaagaaaaaggatttactgctcaagatattcaagttttagca
cccatgtacagaggtccagccggtatagatgcattgaataaaatgatgcaagaaatcttt
aatccaaatccttctggcagacgaaaagaagttaaatttaacgataagaattaccgcatt
ggggacaaggtattgcagttggtaaactacccggaaatgaacgtatttaatggagacatg
ggagagattgtcgggatcaatttagctaaagagaccgatgataaagtagatgaaatcgtg
attcaatttgatgccaatgaagtcgtctacaaacgaaatgaatggatgaagattacgctg
gcctattgttgttcgattcataagtctcaaggctcagaatttaaaatggttattttacca
atggtgcaaaattatcaccgtatgttaagacgtgatctactgtatacaggaattacaaga
agtagtgaattgcttattttatgtggcgaacctaatgcttttgaggaatgtgtagcaaaa
tcttccgcaaccagactcacgacactgacagaacgtttattaggagaagaccagcatgtt
gaacttgttgtgaaaatgcctgctaataaagatgagctaaaagaaacagagatatcagat
tctatttctactctatcatcagcaacagaaaataaaactgaaacgataaataaagaagaa
ccgaagaattatcgtctgacaattgaaatgatccaatccaatgcgattgatccgatgatt
ggtatggatgggatagtaccaagtatataa

DBGET integrated database retrieval system