KEGG   Carnobacterium sp. 17-4: CAR_c09200Help
Entry
CAR_c09200        CDS       T01452                                 

Gene name
pdhC
Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:crn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:crn00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:crn00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:crn00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943975..945582
Genome map
AA seq 535 aa AA seqDB search
MSFKFKLPDVGEGMAEGEIVKWLVAEGDTIEEEDSIVEIQNDKSVEEIATPVSGTVKKIM
VEEGTVATVGQVIIEIDAPGYEDEESVPATSPEAPAASAPEPAAAPAASGTSFFQFKMPD
VGEGMAEGEIVKWLVAEGDTVNEEDSVAEIQNDKSVEEIATPVSGTIKKILVEEGTVAMV
GQVLIEIDSPEHNPEGSAPAAQEATAAPAVTSTSTEASASNKNVLAMPSVRQFARENDVD
ITLVAASGKNGRTTKEDIENFKKNGGKATEVAAPAEKATEAKAPAAKKEAAPAKAFKSNQ
AELETREAMTPMRKAIAKAMVNSKATAPHVTLFDEVDSTKLMAHRKHFKDIAAGKGVKLT
FLPYVVKAIVSVLRKYPALNASIDDLTNEIVYKHYFNIGIATDTDRGLFVPVIKDADAKS
IFSIAGEITELSGKATEGKLAANEMSNGSISISNIGSIGGGWFTPVINYPEVAILGVGRI
AKKAVVNADDEIVVAPVMQLSLSFDHRIIDGATAQKAMNELKTLLADPELLLMEG
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaaatttaaattaccagacgttggagaaggaatggctgaaggcgaaatcgta
aaatggttagtagctgaaggcgatacaattgaagaagaagattcaatcgtagaaatccaa
aacgacaaatctgtagaagaaattgcaacaccagtttctggaaccgttaaaaaaattatg
gttgaagaaggaactgtagcaacagttggacaagttattatcgaaattgacgctcctgga
tacgaagacgaggaatctgttccagctacttcaccagaagcaccagctgcatctgctcca
gaacctgcagcagcaccagctgcatcaggaacttcattcttccaattcaaaatgccagac
gttggagaaggaatggctgaaggcgaaatcgtaaaatggttagtagctgaaggtgatacc
gttaatgaagaagattctgttgcagaaatccaaaacgataaatctgtagaagagattgca
actccagtttctggaacaatcaaaaagattttagttgaagaaggaactgtagcaatggta
ggtcaagtattaatcgaaattgactctccagagcacaaccctgaaggttcagcaccagct
gctcaagaagctacagctgcaccagctgtaacatcaacttcaacagaagcatcagcttca
aataaaaatgttttagctatgccatctgtacgtcaatttgctcgtgaaaacgatgttgac
atcactttagttgctgcttctggtaaaaatggtcgcacaactaaagaagatattgaaaac
ttcaagaaaaatggtggaaaagcaactgaagttgcagcaccagctgaaaaagcaactgaa
gctaaagctccagcagctaagaaagaagctgctccagctaaagcattcaaatctaaccaa
gctgaacttgaaactcgtgaagcaatgactccaatgcgtaaagctatcgctaaagcaatg
gtaaacagcaaagcgactgctccacatgttacattgtttgatgaagtagactcaactaaa
ttgatggctcaccgtaaacactttaaagatatcgcagcaggcaaaggcgttaaattaaca
ttcttgccttacgttgttaaagctatcgtttcagtattacgtaaatatccagcattgaat
gcatcaattgatgatttaacaaacgaaattgtttacaaacattacttcaacattggtatt
gctactgatactgatcgtggattgtttgttccagttatcaaagatgctgatgctaagagc
attttctctatcgctggcgaaatcactgaactttctggtaaagctacagaaggtaaattg
gcagctaatgaaatgagtaatggttcaatctcaatcagtaacattggttcaatcggcggc
ggctggttcactccagtaatcaactaccctgaagttgctattttaggtgtaggccgtatc
gctaaaaaagcagttgttaacgcagacgacgaaatcgttgtagcaccagttatgcaattg
tcattaagctttgaccaccgtatcattgatggagcaactgcacaaaaagcaatgaatgaa
ttgaaaacattgcttgctgatccagaattattattaatggaagggtaa

DBGET integrated database retrieval system