KEGG   Carnobacterium sp. 17-4: CAR_c09200Help
Entry
CAR_c09200        CDS       T01452                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
crn  Carnobacterium sp. 17-4
Pathway
crn00010  Glycolysis / Gluconeogenesis
crn00020  Citrate cycle (TCA cycle)
crn00620  Pyruvate metabolism
crn01100  Metabolic pathways
crn01110  Biosynthesis of secondary metabolites
crn01120  Microbial metabolism in diverse environments
crn01130  Biosynthesis of antibiotics
crn01200  Carbon metabolism
Module
crn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c09200 (pdhC)
   00020 Citrate cycle (TCA cycle)
    CAR_c09200 (pdhC)
   00620 Pyruvate metabolism
    CAR_c09200 (pdhC)
Enzymes [BR:crn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CAR_c09200 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 RnfC_N GCV_H HlyD_D23 DUF1533
Motif
Other DBs
NCBI-ProteinID: AEB29613
UniProt: F4BPS8
Position
943975..945582
Genome map
AA seq 535 aa AA seqDB search
MSFKFKLPDVGEGMAEGEIVKWLVAEGDTIEEEDSIVEIQNDKSVEEIATPVSGTVKKIM
VEEGTVATVGQVIIEIDAPGYEDEESVPATSPEAPAASAPEPAAAPAASGTSFFQFKMPD
VGEGMAEGEIVKWLVAEGDTVNEEDSVAEIQNDKSVEEIATPVSGTIKKILVEEGTVAMV
GQVLIEIDSPEHNPEGSAPAAQEATAAPAVTSTSTEASASNKNVLAMPSVRQFARENDVD
ITLVAASGKNGRTTKEDIENFKKNGGKATEVAAPAEKATEAKAPAAKKEAAPAKAFKSNQ
AELETREAMTPMRKAIAKAMVNSKATAPHVTLFDEVDSTKLMAHRKHFKDIAAGKGVKLT
FLPYVVKAIVSVLRKYPALNASIDDLTNEIVYKHYFNIGIATDTDRGLFVPVIKDADAKS
IFSIAGEITELSGKATEGKLAANEMSNGSISISNIGSIGGGWFTPVINYPEVAILGVGRI
AKKAVVNADDEIVVAPVMQLSLSFDHRIIDGATAQKAMNELKTLLADPELLLMEG
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaaatttaaattaccagacgttggagaaggaatggctgaaggcgaaatcgta
aaatggttagtagctgaaggcgatacaattgaagaagaagattcaatcgtagaaatccaa
aacgacaaatctgtagaagaaattgcaacaccagtttctggaaccgttaaaaaaattatg
gttgaagaaggaactgtagcaacagttggacaagttattatcgaaattgacgctcctgga
tacgaagacgaggaatctgttccagctacttcaccagaagcaccagctgcatctgctcca
gaacctgcagcagcaccagctgcatcaggaacttcattcttccaattcaaaatgccagac
gttggagaaggaatggctgaaggcgaaatcgtaaaatggttagtagctgaaggtgatacc
gttaatgaagaagattctgttgcagaaatccaaaacgataaatctgtagaagagattgca
actccagtttctggaacaatcaaaaagattttagttgaagaaggaactgtagcaatggta
ggtcaagtattaatcgaaattgactctccagagcacaaccctgaaggttcagcaccagct
gctcaagaagctacagctgcaccagctgtaacatcaacttcaacagaagcatcagcttca
aataaaaatgttttagctatgccatctgtacgtcaatttgctcgtgaaaacgatgttgac
atcactttagttgctgcttctggtaaaaatggtcgcacaactaaagaagatattgaaaac
ttcaagaaaaatggtggaaaagcaactgaagttgcagcaccagctgaaaaagcaactgaa
gctaaagctccagcagctaagaaagaagctgctccagctaaagcattcaaatctaaccaa
gctgaacttgaaactcgtgaagcaatgactccaatgcgtaaagctatcgctaaagcaatg
gtaaacagcaaagcgactgctccacatgttacattgtttgatgaagtagactcaactaaa
ttgatggctcaccgtaaacactttaaagatatcgcagcaggcaaaggcgttaaattaaca
ttcttgccttacgttgttaaagctatcgtttcagtattacgtaaatatccagcattgaat
gcatcaattgatgatttaacaaacgaaattgtttacaaacattacttcaacattggtatt
gctactgatactgatcgtggattgtttgttccagttatcaaagatgctgatgctaagagc
attttctctatcgctggcgaaatcactgaactttctggtaaagctacagaaggtaaattg
gcagctaatgaaatgagtaatggttcaatctcaatcagtaacattggttcaatcggcggc
ggctggttcactccagtaatcaactaccctgaagttgctattttaggtgtaggccgtatc
gctaaaaaagcagttgttaacgcagacgacgaaatcgttgtagcaccagttatgcaattg
tcattaagctttgaccaccgtatcattgatggagcaactgcacaaaaagcaatgaatgaa
ttgaaaacattgcttgctgatccagaattattattaatggaagggtaa

DBGET integrated database retrieval system