KEGG   Carnobacterium sp. 17-4: CAR_c10100Help
Entry
CAR_c10100        CDS       T01452                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAR_c10100 (pfkA)
   01230 Biosynthesis of amino acids
    CAR_c10100 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c10100 (pfkA)
   00030 Pentose phosphate pathway
    CAR_c10100 (pfkA)
   00051 Fructose and mannose metabolism
    CAR_c10100 (pfkA)
   00052 Galactose metabolism
    CAR_c10100 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CAR_c10100 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CAR_c10100 (pfkA)
Enzymes [BR:crn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CAR_c10100 (pfkA)
Protein phosphatases and associated proteins [BR:crn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CAR_c10100 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1041840..1042802
Genome map
AA seq 320 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKGLYEGMEVYGINYGYAGLVAGDIRKLTRRDVGDK
ISRGGTFLYSARYPEFATEEGQLKGIEQLNKFGIEGLVVIGGDGSYMGAAALTRHGYPTV
ALPGTIDNDIPGTDFCIGFDTAINTVLDSVDKIRDTATSHVRTFIIEVMGRNAGDIALWT
GVAGGAEQIIIPETEFNMEEIASTIQKGRERGKKHSIIILAEGVMNGNDFADELSKFGDY
QARVTVLGHVQRGGSPTARDRVLSSVFGARAVDLLKVGKGGLCIGIVNNKIVENDIVETL
KTKKHMPDVSLYKLNQEISY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgacaagtggtggagatgctccaggaatgaatgcagctatt
cgagctgttgtgcgtaaaggtctttatgaaggtatggaagtatatggtattaactatggc
tatgctggtttggtggctggtgatatacgtaaattaactcgtagagatgtaggtgataag
atttcgagaggtggaacttttctctattctgctcgttatcctgaatttgctactgaagaa
ggtcaattaaaaggtattgaacaactaaataaatttgggattgaaggtttagtagttatt
ggcggagacggttcttatatgggtgctgctgcgttaactagacacggttatccaactgta
gctttaccaggtacgatcgataacgatataccaggtactgatttctgtattggatttgat
acggctattaatactgtattagattcggttgataaaatccgtgatactgcaacaagtcac
gtgcgtacttttattattgaagttatgggacgtaatgcaggagatatcgcattatggact
ggtgtagcaggtggagcagaacaaattattattcctgaaacagaatttaatatggaagaa
attgcaagcacgattcaaaaaggccgtgaacgcggtaaaaaacacagtatcattattttg
gctgaaggcgtaatgaacggaaacgactttgcggatgaattgtcaaaatttggagattat
caagctcgtgttactgttctagggcatgttcagcgtggaggttctccaactgctcgtgac
cgagtattatcaagtgtttttggtgcgagagctgttgatctattaaaagttggtaaaggc
ggattatgcataggaatcgtaaacaataaaattgttgaaaatgatattgttgaaaccttg
aaaacaaaaaaacatatgcctgatgtcagcttatacaaattaaatcaagaaatatcttat
taa

DBGET integrated database retrieval system