KEGG   Carnobacterium sp. 17-4: CAR_c10560Help
Entry
CAR_c10560        CDS       T01452                                 

Gene name
dfrA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
crn  Carnobacterium sp. 17-4
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAR_c10560 (dfrA)
   00670 One carbon pool by folate
    CAR_c10560 (dfrA)
Enzymes [BR:crn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CAR_c10560 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1090546..1091037
Genome map
AA seq 163 aa AA seqDB search
MIAFLWAQDKNGAIGYKGTLPWYLPNDLKFFKQMTINNAVVMGRKTFEGMNKRPLPDRIN
IILTTDLNYQAEGVKIMHSREEVLDFAKDYSGDTFITGGAKVFSFFMDDVDVLHRTMIEG
EFEGDTFIPEIDWTKWKLEKIEEGVLDERNKYPHVFETYARKK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttttttatgggctcaagataaaaatggtgcaattgggtataaaggtactttg
ccttggtatctgccaaatgatttaaagtttttcaaacaaatgactataaataacgctgta
gtgatgggaagaaaaacgtttgaaggaatgaacaaacgtcctttaccagaccgtatcaat
attattttaactactgatcttaattatcaggctgaaggggtcaaaatcatgcacagccga
gaagaagtgttggattttgcaaaagactactctggagatacgtttattactgggggagcg
aaagtgtttagcttctttatggatgacgtggatgtattgcaccgcacaatgatcgaaggc
gagtttgaaggagatacctttattccagaaatagattggacgaaatggaaacttgagaaa
atagaagagggcgttttagatgaacgcaataagtaccctcacgtttttgaaacatatgca
cggaaaaagtaa

DBGET integrated database retrieval system