KEGG   Carnobacterium sp. 17-4: CAR_c13200Help
Entry
CAR_c13200        CDS       T01452                                 

Gene name
glcK
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
crn  Carnobacterium sp. 17-4
Pathway
crn00010  Glycolysis / Gluconeogenesis
crn00052  Galactose metabolism
crn00500  Starch and sucrose metabolism
crn00520  Amino sugar and nucleotide sugar metabolism
crn00521  Streptomycin biosynthesis
crn01100  Metabolic pathways
crn01110  Biosynthesis of secondary metabolites
crn01120  Microbial metabolism in diverse environments
crn01130  Biosynthesis of antibiotics
crn01200  Carbon metabolism
Module
crn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
crn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c13200 (glcK)
   00052 Galactose metabolism
    CAR_c13200 (glcK)
   00500 Starch and sucrose metabolism
    CAR_c13200 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CAR_c13200 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CAR_c13200 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CAR_c13200 (glcK)
Enzymes [BR:crn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CAR_c13200 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase DNA_ligase_OB FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEB30011
UniProt: F4BRU1
Position
complement(1362804..1363778)
Genome map
AA seq 324 aa AA seqDB search
MTKKIIGIDLGGTTVKFAILTSEGDIQQKWSLVTDTTENGSRIVPAIVESINEQLEKYQL
TPDDFIGIGMGSPGTVDRKAGTVIGAYNLNWKTSQPVKKIIEEGTGISFAIDNDANVAAL
GERWKGAGANEEDVVFITLGTGVGGGIIAGGRLIHGVAGAAGELGHITVDPEGYDCTCGK
KGCLETVASATGVVRLARDFSEDYAGESQLKYNIDDGQLITAKDVFDFAKENDKLAVLVV
EKVAYFLGLACASVANTLNPSTIVIGGGVSNAGVFLVDQIKVYFDKFTYPTIRETTKIRL
AQLGNNAGVVGASSLIKEHLNGTL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaaatcattggaatcgatttaggtggaacaactgtaaaatttgctattcta
acaagtgaaggggatattcaacaaaaatggagtcttgtaacagacacaactgaaaacgga
tcacgaattgttccagctattgttgaatcgatcaatgagcagcttgaaaaatatcaatta
actccagatgacttcattggaatcgggatgggatcgcccggaacggttgatcgtaaagcc
ggaaccgttattggtgcatataacttgaattggaaaacaagccagccggttaaaaaaata
atcgaagaaggcactggaatttcatttgctatcgataatgatgcaaatgtagcggctctt
ggcgaacgctggaagggcgctggagcaaatgaagaagatgtcgtgtttatcactttagga
actggtgttggtggtggaattattgctggtggacggttaattcatggtgttgctggtgct
gcaggagaacttggacatattacagtggatccagaaggatacgactgtacatgtggaaag
aaaggttgtctggagactgtagcaagtgctacaggagttgtgcgtttagctagagacttt
tcagaagattacgctggcgaatcacaattgaaatacaatattgacgatggtcaattaata
actgccaaagatgtttttgattttgcgaaagaaaatgacaaattagctgttctagtggta
gaaaaagtagcttactttttaggcttagcatgtgcgagtgttgcaaatacgttaaatcca
tctaccattgtaattggcggaggtgtttctaatgctggagtattcttagttgatcaaatc
aaagtatattttgataaatttacttatccaactattcgtgaaacgacaaaaattagatta
gctcaattaggaaacaatgcaggtgtagttggagccagttcattaattaaagaacatttg
aatggaactctttaa

DBGET integrated database retrieval system