KEGG   Carnobacterium sp. 17-4: CAR_c13200Help
Entry
CAR_c13200        CDS       T01452                                 

Gene name
glcK
Definition
glucose kinase (EC:2.7.1.2 2.7.1.55)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAR_c13200 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c13200 (glcK)
   00052 Galactose metabolism
    CAR_c13200 (glcK)
   00500 Starch and sucrose metabolism
    CAR_c13200 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CAR_c13200 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CAR_c13200 (glcK)
   00524 Butirosin and neomycin biosynthesis
    CAR_c13200 (glcK)
Enzymes [BR:crn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CAR_c13200 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1362804..1363778)
Genome map
AA seq 324 aa AA seqDB search
MTKKIIGIDLGGTTVKFAILTSEGDIQQKWSLVTDTTENGSRIVPAIVESINEQLEKYQL
TPDDFIGIGMGSPGTVDRKAGTVIGAYNLNWKTSQPVKKIIEEGTGISFAIDNDANVAAL
GERWKGAGANEEDVVFITLGTGVGGGIIAGGRLIHGVAGAAGELGHITVDPEGYDCTCGK
KGCLETVASATGVVRLARDFSEDYAGESQLKYNIDDGQLITAKDVFDFAKENDKLAVLVV
EKVAYFLGLACASVANTLNPSTIVIGGGVSNAGVFLVDQIKVYFDKFTYPTIRETTKIRL
AQLGNNAGVVGASSLIKEHLNGTL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaaatcattggaatcgatttaggtggaacaactgtaaaatttgctattcta
acaagtgaaggggatattcaacaaaaatggagtcttgtaacagacacaactgaaaacgga
tcacgaattgttccagctattgttgaatcgatcaatgagcagcttgaaaaatatcaatta
actccagatgacttcattggaatcgggatgggatcgcccggaacggttgatcgtaaagcc
ggaaccgttattggtgcatataacttgaattggaaaacaagccagccggttaaaaaaata
atcgaagaaggcactggaatttcatttgctatcgataatgatgcaaatgtagcggctctt
ggcgaacgctggaagggcgctggagcaaatgaagaagatgtcgtgtttatcactttagga
actggtgttggtggtggaattattgctggtggacggttaattcatggtgttgctggtgct
gcaggagaacttggacatattacagtggatccagaaggatacgactgtacatgtggaaag
aaaggttgtctggagactgtagcaagtgctacaggagttgtgcgtttagctagagacttt
tcagaagattacgctggcgaatcacaattgaaatacaatattgacgatggtcaattaata
actgccaaagatgtttttgattttgcgaaagaaaatgacaaattagctgttctagtggta
gaaaaagtagcttactttttaggcttagcatgtgcgagtgttgcaaatacgttaaatcca
tctaccattgtaattggcggaggtgtttctaatgctggagtattcttagttgatcaaatc
aaagtatattttgataaatttacttatccaactattcgtgaaacgacaaaaattagatta
gctcaattaggaaacaatgcaggtgtagttggagccagttcattaattaaagaacatttg
aatggaactctttaa

DBGET integrated database retrieval system