KEGG   Carnobacterium sp. 17-4: CAR_c15150Help
Entry
CAR_c15150        CDS       T01452                                 

Gene name
glpO2
Definition
glycerol-3-phosphate oxidase (EC:1.1.3.21)
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CAR_c15150 (glpO2)
Enzymes [BR:crn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     CAR_c15150 (glpO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1554969..1556807)
Genome map
AA seq 612 aa AA seqDB search
MAFSIERRKQDIKALKEETLDVLIIGGGITGAGTALQASASGLKTGLVEMQDFAEGTSSR
STKLVHGGLRYLKNFDVEVVADTVQERAVVQGIAPHIPKADPMILPIYDEPGSTFSMFSL
KVAMDLYDQLASVTGTKYANYTLTKEEVLEREPQLKSEGLLGAGVYLDYRNNDARLVIEN
IKRAAADGGHMVSRMKVVGILHDENDKANGAKVEDLLTGETFDIKARVVLNSTGPWSDTI
RQMDAKLDAIPQMRPTKGVHLVVDSKKLYVPQPTYFDTGKNDGRMVFVIPREEKTYFGTT
DTDYKGDFAHPTVEQEDVDYLLEIVNNRYPSAEITIDDIESSWAGLRPLISSNGGSDYNG
GNSQPISDESFNNVLSTIEQFQKGEVDRYTVEDALKNIETSNSESEDNPSAISRGSALDI
DEDGMITVAGGKITDYRKMALGAMEAVIEILQNDFNISYELIDSAKYPVSGGEISPQEVD
EETEKLAQMGVEKGLSESEAMYLANLYGSNAPDVFALLDEVEQVEGLTLADTLSLWYAMK
EEMALTPNDFLIRRTNHMLFMRDTLDGIIKPVIAEMARYYGWTDEAKAAHIVKLNTAIAE
SDLKKLKGDGNR
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggctttttcgattgaacgaagaaagcaagatatcaaagcattaaaagaagaaacattg
gacgttttaattattggtggagggatcacaggtgctgggactgctttgcaagccagcgct
tctggtcttaaaacagggcttgttgaaatgcaagactttgctgaaggaacctcttcacgc
tcgacgaaattagttcacggtggattacgttatttgaaaaacttcgatgttgaagttgta
gcggatacagttcaagaacgtgctgtcgtgcaaggaatcgcacctcacattccaaaagct
gacccgatgatcttgccaatctatgacgaacccggttctacgttctctatgttctcttta
aaagtagcgatggatctatacgatcaattagctagtgttactggaacaaaatatgcgaac
tacacattaacaaaagaggaagttctagaacgtgaaccgcaactgaaaagcgaaggctta
ctcggtgcaggtgtgtatctagattaccggaacaacgatgctcgtttagtaattgaaaac
atcaaacgtgctgctgcagatggcggacacatggtcagtcgtatgaaagtagtgggcatt
ttgcatgatgaaaacgacaaagccaatggtgcaaaagtagaagacttgttaactggtgaa
acatttgatattaaagctcgcgttgtcttgaattcaactggtccttggtcggacacgatt
cgtcaaatggacgctaaattagacgctataccacaaatgcgcccaacaaaaggggttcac
ttggttgtagacagcaaaaaattatacgttccacaacccacttattttgataccggtaaa
aacgatggccgtatggtatttgtgattcctcgtgaagaaaaaacgtactttggaacaacg
gatacagattacaaaggtgactttgcacatccaactgttgagcaagaagacgttgattat
ttactagaaatagttaataaccgttacccttcagctgaaatcacgattgatgacatcgaa
tcaagttgggcaggattgcgcccgttgatttcgtcaaatggtggttctgactacaatggt
ggcaatagccaaccaatctcagatgaaagttttaacaatgtcctttctacaatcgaacaa
ttccaaaagggggaagtcgaccgttatacagtagaagacgcattgaaaaatatcgaaaca
agcaactctgaatcagaagacaacccttcagcgatttcacgtggaagtgcgttagacatt
gatgaagacggtatgatcacagtagctggtggaaagataactgactatcgtaaaatggca
cttggcgcgatggaagctgtgattgagatcttgcaaaacgatttcaacatctcttatgaa
ttgattgattctgctaagtacccagtatctggtggagaaatcagcccgcaagaagtggat
gaagaaacagaaaaattagcccaaatgggtgttgaaaaaggcttaagcgaatccgaagcc
atgtaccttgctaacctttatggatccaacgctcctgacgtatttgctttgcttgatgaa
gtagaacaagtagaggggttaactctagcagatacactaagcttatggtatgctatgaag
gaagaaatggcgcttacaccaaatgacttcttaatccgtcgcacaaatcatatgttattt
atgcgcgacactttagatggtataataaaaccagtgattgctgaaatggcccgctattat
ggctggacagatgaagcaaaagctgctcacatagtaaaattaaacactgcaattgcagag
tctgatttaaaaaaattaaaaggagatggaaatagatga

DBGET integrated database retrieval system