KEGG   Carnobacterium sp. 17-4: CAR_c15160Help
Entry
CAR_c15160        CDS       T01452                                 

Gene name
glpK3
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CAR_c15160 (glpK3)
Enzymes [BR:crn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CAR_c15160 (glpK3)
Exosome [BR:crn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAR_c15160 (glpK3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1556824..1558329)
Genome map
AA seq 501 aa AA seqDB search
MTEKKYIMAIDQGTTSSRAIIYDKKTNTIGSSQKEFTQIFPQSGWVEHNPNEIWNSVQSV
IAGAFIESGVKPAEIAAIGITNQRETTIIWDKKTGRPIYNAIVWQSRQSAPIAAKLNEDG
HSKMIHEKTGLIIDSYFSATKIRWILDHVEGAQERAEKGELMFGTVDTWLVWKLTGGDSY
VTDYSNASRTMLFNIHKLEWDQDILDLLNIPIVMMPEVKSNSEVYGNTTNYHFYGANIPI
SGMAGDQQAALFGQMAFEPGMVKNTYGTGSFIVMNTGEKPQLSENNLLTTIGYGINGKIY
YALEGSIFVSGSSIQWLRDGLKMIENSADSEALAKASKNDNEVFVVPAFTGLGAPYWDSD
ARGSVFGLNRGTTKEDFVKATLQSIAYQSRDVIDTMNKDAGIDIPLLKVDGGAANNDWLL
QFQADILGTKVQRAHNLETTALGAAYLAGLAVGFWESMDEIRDMYEEGGIFEPQMGDAER
EKLYKNWKLAVKATQVFKPEA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaaaaaatatattatggctattgatcaaggaacaacgagttcaagagcaatt
atttatgataaaaaaacaaatacgattgggagctcacaaaaagagttcactcaaattttt
ccacaaagtggttgggtagaacacaacccgaatgaaatctggaattcagtgcaatctgtt
attgctggtgcgtttattgaatccggtgtcaaaccagcagagatcgctgcaattgggatt
acgaaccaacgtgaaacaacaattatctgggataaaaaaacaggtcgtccaatttacaac
gcgattgtttggcaatcacgccaatcagcacctattgctgctaaattaaatgaagatgga
cattctaaaatgattcatgaaaaaactggattaatcattgattcttatttctcagctact
aaaatccgctggatcctagaccatgtagaaggcgcacaagagcgtgctgaaaaaggtgag
ttaatgtttggaactgttgacacatggttagtatggaaattaacgggtggagattcatac
gttacggattattcaaacgccagccgtacaatgttgttcaacattcataaattagaatgg
gatcaagacattttagacttattaaatattccaattgttatgatgccagaagtgaaatcc
aactcagaagtttacggaaacacaacgaactaccatttctatggagcgaacattccaatc
tcaggaatggctggagaccaacaagctgctttattcggtcaaatggcttttgaacctgga
atggtgaaaaacacttacggaactggttcatttatcgtaatgaatacaggagaaaaacca
caattatcagaaaacaatttgttaacaacgattggatatggaattaatggcaaaatttac
tatgctttagaaggaagtatttttgtatcaggatcgtcaatccaatggttgcgtgatgga
ttaaaaatgattgaaaattcagctgactcagaagcacttgctaaagcgtctaaaaacgac
aatgaagtatttgtggtaccagccttcactggccttggagcaccatactgggattcagat
gcacgtggatctgtcttcggattgaaccgtggaacaacgaaagaagactttgttaaagct
actttacaatctattgcttaccaatcacgcgatgttattgatacaatgaacaaagacgca
ggcattgatattccattattgaaagtagatggcggagctgcaaataacgactggttattg
caattccaagcagacatcttaggaactaaagtccaacgtgcacacaacttagaaacgact
gctttaggtgcagcttacttagctggtttagctgttggattctgggaaagcatggacgaa
atcagagatatgtatgaagaaggtggtatctttgaaccacaaatgggagatgcagagcgc
gaaaaactatacaaaaactggaaactagcagttaaagctacacaagtatttaagcctgaa
gcataa

DBGET integrated database retrieval system