KEGG   Carnobacterium sp. 17-4: CAR_c16940Help
Entry
CAR_c16940        CDS       T01452                                 

Gene name
murAA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:crn00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:crn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1762696..1764006)
Genome map
AA seq 436 aa AA seqDB search
MEKIVVRGGKHLAGTVKVEGAKNAVLPILAASILASKGQSKLTNVPILSDVFTINEVLSH
LNLTVDFNETEKEITLDATKELHYEAPFEYVSKMRASIVVMGPLLARLGHAKVALPGGCA
IGTRPIDLHLKGFEAMGAEVHIENGYIEAFADQLKGAHIYLDFPSVGATQNIMMAATLAK
GTTTIENVAREPEIVDLANFLNRMGAKVVGAGTESIRIEGVTELTGTEHSIIPDRIEAGT
FMIAAAVTKGNIFIEDAVAEHNKPLISKLKEMGVQFKDEDNGLRVIGPDKLKATDVKTMP
HPGFPTDMQAQMTIAQVFAEGTSTMKETVFENRYMHMEELRRMNAEFKIEGQTLVIYGPS
ELQGAEVAATDLRAAAALIIAGLVSKGYTRVTHLEYLDRGYYEFHKKLQGLGADVERIEE
SVEIAMEETELERLFS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaattgtcgttcgtggtggaaaacacctagctggtacagtgaaagtagaaggg
gcaaaaaatgccgtattacctattttagctgctagcattttagcaagtaagggacaaagt
aaattaacgaatgttcccatattatctgacgtattcactattaatgaagttttaagccac
ttgaatttaactgttgattttaacgaaactgaaaaagaaattactttagacgctacaaag
gaattacattatgaggctccttttgaatatgtaagtaaaatgcgtgcatcaatcgtcgta
atgggacctctcttagctcgattaggacacgcaaaagttgctcttcctggaggatgtgca
ataggaacacgtccgatagatttgcatttaaaaggatttgaagcgatgggtgcggaagta
catatcgaaaatggatatatcgaagcattcgccgatcaattaaaaggagctcacatctac
ttagattttccaagtgtaggagctacacaaaatattatgatggctgccacactagctaaa
ggaacaactaccattgaaaacgttgcgcgcgagccagaaattgttgacttagcaaacttc
ttaaatcgtatgggtgctaaagttgttggtgctggtacagagagtatccgtattgaaggt
gtaacagagttaactggtacggagcatagtattattccagatcgtattgaagctggtaca
tttatgattgcagctgctgttacgaaaggaaacatttttattgaagatgctgttgcagaa
cacaacaaaccattgatttctaagttaaaagaaatgggtgttcaatttaaagacgaagat
aacggattacgtgttatcggacctgataaattaaaagcaaccgatgtaaaaacaatgccg
catcctggtttcccaacagatatgcaagcacaaatgacaattgcgcaagtgtttgctgaa
ggtacaagtacaatgaaagaaactgtatttgaaaaccgttatatgcatatggaagaattg
cgtcgtatgaatgctgaatttaaaattgaaggtcaaacgttagttatctacggaccatct
gagttgcaaggagctgaagtagcagcgacggatcttagagcagccgctgctttgattatc
gctggcttggtttcgaaaggttatacaagagtaacacatttagaatacctagatcgcggt
tattatgaattccataaaaaattacaaggcttaggtgcagatgtagaacgcattgaagag
tctgtagaaatcgctatggaagaaactgaacttgagcgattattctcgtaa

DBGET integrated database retrieval system