KEGG   Carnobacterium sp. 17-4: CAR_c17090Help
Entry
CAR_c17090        CDS       T01452                                 

Gene name
murD2
Definition
putative UDP-N-acetylmuramoylalanine--D-glutamate ligase MurD
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CAR_c17090 (murD2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAR_c17090 (murD2)
Enzymes [BR:crn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CAR_c17090 (murD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1777815..1779179
Genome map
AA seq 454 aa AA seqDB search
MEETQLSIRSAFAIAVGRTTKWGLHTFFKGGSSYPGQLTQKLDPTVLGTLSRNYDVVIVT
GTNGKTLTTALTYQVLKQKYPEIITNPTGANMLQGIISTFLEHHSYTNNTEKKAAVLEVD
EASLIHVTKYIKPKAIVFTNVFRDQMDRYGEIYTTYQMMLNGAALAPDALIVSNGDAPIF
NSKETINKRVYFGFDHLPDGELKAHYNTDGVLCPHCNNILHYKFLTYSNLGKYYCPNCDF
KRPELTYRLTDLTHMDHESSKFEIDGEDFEIKIGGQYNIYNALAAYSVGRILDVSTDQIR
AGFAASKRVFGRQEVIQIDDKEITINLVKNPVGLNQVLDMINLTPEPFSLVSILNANYAD
GTDVSWIWDANYEIVPNMNIKQVTVGGERVEDITARLEVAGIPEEELQVIPSIPEIIKSF
KNAPTKKIYVLATYTAVLQLRKELANQGYIEGGM
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
ttggaggaaactcaattgagtatacgtagtgcatttgccatcgcagtaggaagaacaact
aaatggggacttcatacgttctttaaaggcggaagtagttatcccggtcaactaacacag
aaattagatcctaccgtattaggtactttatcaagaaattacgatgttgttattgttacc
ggaactaatggtaaaacattaacgaccgcattgacttatcaagttttaaaacaaaaatac
cctgaaattattacaaaccctactggagcaaatatgctgcaaggaatcatttcaactttt
cttgaacatcactcttacacaaataacactgagaaaaaggctgccgttcttgaagtagat
gaagccagtttgattcatgtaacaaaatatattaaaccaaaagcgattgtgtttacgaat
gttttccgtgatcaaatggatcgctatggtgaaatttatacgacttatcaaatgatgttg
aatggtgcagcgttagctccagatgctttaattgttagtaatggagatgctccaattttc
aattcaaaagaaaccattaacaaacgtgtatactttggttttgaccaccttccagatggg
gaattaaaagctcattacaataccgatggtgtcttgtgtccacattgcaacaatatttta
cattacaaatttttaacgtatagcaatctagggaaatattattgtcctaattgcgatttc
aaacgtccagaattgacgtatcgtttaacggacttgactcatatggatcatgaatcgtct
aaatttgaaatcgacggagaagactttgaaattaaaattggtggacaatacaatatctat
aatgccttagctgcttatagtgttggtcggatattagatgtttctactgatcaaattcgc
gctggatttgccgcatcaaaacgagtttttggtcgtcaagaggtcattcaaatcgatgac
aaagaaattacgattaacttagttaaaaatcctgttggtttgaaccaagtcttggatatg
atcaacttaactccagaaccgttctctctcgtttcaattttaaatgcaaactatgcggat
ggaacagatgtcagctggatttgggatgcaaattacgagatcgttcctaatatgaatatc
aaacaagtcactgttggtggtgaacgagtagaagatatcactgctcgtttagaagttgct
ggaattcctgaagaagaacttcaagttatcccgagcatacctgaaataattaagagcttt
aaaaatgcgccaacaaaaaaaatctacgtactagctacttatactgctgtcttacaattg
cgtaaagagttagcaaaccaaggttatattgagggaggtatgtaa

DBGET integrated database retrieval system