KEGG   Carnobacterium sp. 17-4: CAR_c18220Help
Entry
CAR_c18220        CDS       T01452                                 

Gene name
gpmA2
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAR_c18220 (gpmA2)
   01230 Biosynthesis of amino acids
    CAR_c18220 (gpmA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c18220 (gpmA2)
  Energy metabolism
   00680 Methane metabolism
    CAR_c18220 (gpmA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAR_c18220 (gpmA2)
Enzymes [BR:crn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CAR_c18220 (gpmA2)
Exosome [BR:crn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CAR_c18220 (gpmA2)
  Exosomal proteins of melanoma cells
   CAR_c18220 (gpmA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1901114..1901785
Genome map
AA seq 223 aa AA seqDB search
MRHGLSEWNLLNQFTGWMDADLSEQGYEEARKAGQKIKNAGINFDFAFTSVLKRAIKTCH
IVLEESDQLWVPETKSWRLNERHYGALQGLNKQATAEKFGSEQVLIWRRSYDTLPPLLKP
DDPNSALNDRRYANLQKRTIPMGESLKVTLERVIPFWEDHIAPAILDNKTVLIAAHGNSI
RALIKYLEEISDDEIMAVEIPTGQPLVYELNEELIVTKKYYLD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacatggattaagcgaatggaatttattaaaccaatttacaggctggatggatgct
gatttaagcgagcaagggtatgaagaagcacgcaaagctgggcaaaagattaaaaatgct
ggcatcaactttgattttgcttttacatctgttttgaaaagagccattaagacttgccat
attgtcttagaagaatcggaccaattatgggttccagaaacaaaatcatggcggttaaat
gaacgtcattatggggctttgcaaggattaaacaaacaagcaacagctgaaaaatttggt
tcagaacaagttctcatttggcgccgttcatatgatactttaccaccattattgaagcca
gatgatccaaactctgcattaaacgatcgccgttatgctaaccttcaaaagcgaactatc
ccgatgggtgaaagtttaaaggtcacactggaacgtgttattcctttttgggaagatcat
atcgctccagctatcttagacaataaaaccgtattgattgctgctcatggaaattccatc
cgggctttgatcaaatacttagaagaaatatcagacgatgaaatcatggctgttgaaatc
ccgactggccaaccgcttgtttacgaactaaatgaagaattaattgttactaaaaagtat
tatttagactaa

DBGET integrated database retrieval system