KEGG   Carnobacterium sp. 17-4: CAR_c18220Help
Entry
CAR_c18220        CDS       T01452                                 

Gene name
gpmA2
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
crn  Carnobacterium sp. 17-4
Pathway
crn00010  Glycolysis / Gluconeogenesis
crn00260  Glycine, serine and threonine metabolism
crn00680  Methane metabolism
crn01100  Metabolic pathways
crn01110  Biosynthesis of secondary metabolites
crn01120  Microbial metabolism in diverse environments
crn01130  Biosynthesis of antibiotics
crn01200  Carbon metabolism
crn01230  Biosynthesis of amino acids
Module
crn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
crn_M00002  Glycolysis, core module involving three-carbon compounds
crn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c18220 (gpmA2)
  Energy metabolism
   00680 Methane metabolism
    CAR_c18220 (gpmA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAR_c18220 (gpmA2)
Enzymes [BR:crn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CAR_c18220 (gpmA2)
Membrane trafficking [BR:crn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CAR_c18220 (gpmA2)
Exosome [BR:crn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CAR_c18220 (gpmA2)
  Exosomal proteins of melanoma cells
   CAR_c18220 (gpmA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEB30479
UniProt: F4BMT3
Position
1901114..1901785
Genome map
AA seq 223 aa AA seqDB search
MRHGLSEWNLLNQFTGWMDADLSEQGYEEARKAGQKIKNAGINFDFAFTSVLKRAIKTCH
IVLEESDQLWVPETKSWRLNERHYGALQGLNKQATAEKFGSEQVLIWRRSYDTLPPLLKP
DDPNSALNDRRYANLQKRTIPMGESLKVTLERVIPFWEDHIAPAILDNKTVLIAAHGNSI
RALIKYLEEISDDEIMAVEIPTGQPLVYELNEELIVTKKYYLD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacatggattaagcgaatggaatttattaaaccaatttacaggctggatggatgct
gatttaagcgagcaagggtatgaagaagcacgcaaagctgggcaaaagattaaaaatgct
ggcatcaactttgattttgcttttacatctgttttgaaaagagccattaagacttgccat
attgtcttagaagaatcggaccaattatgggttccagaaacaaaatcatggcggttaaat
gaacgtcattatggggctttgcaaggattaaacaaacaagcaacagctgaaaaatttggt
tcagaacaagttctcatttggcgccgttcatatgatactttaccaccattattgaagcca
gatgatccaaactctgcattaaacgatcgccgttatgctaaccttcaaaagcgaactatc
ccgatgggtgaaagtttaaaggtcacactggaacgtgttattcctttttgggaagatcat
atcgctccagctatcttagacaataaaaccgtattgattgctgctcatggaaattccatc
cgggctttgatcaaatacttagaagaaatatcagacgatgaaatcatggctgttgaaatc
ccgactggccaaccgcttgtttacgaactaaatgaagaattaattgttactaaaaagtat
tatttagactaa

DBGET integrated database retrieval system