KEGG   Carnobacterium sp. 17-4: CAR_c18290Help
Entry
CAR_c18290        CDS       T01452                                 

Gene name
galM1
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:crn00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:crn00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1907671..1908546)
Genome map
AA seq 291 aa AA seqDB search
MPDQNGNCENVVLGFDSLEEYVKDSPYFGALVGRVAGRIKNGAWATHKLTQNEGPHHIHG
GQVNFSQTVWDAEVNEAADFIDISFTHTSPAGDNGYPGNLTVKVIYQWTEKAVWSMEIQA
ETDATTLFNPTNHTYFNLSGSVKRTILNHKLQIASAVYAEVGADKCPTGRLCPVDGTPYD
FRTPIFMSEALAKQPTGYDTPFKLTTGNVLLSEPESGRQVAIHTTREAVVVFSTTGMDEE
YVVMGKKMCSHLGIALETQELPDAVHHPHFQSIILKPGEQYFSQTTYHFSA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgatcaaaacgggaactgtgaaaatgttgtgttgggttttgatagtcttgaggag
tacgttaaggattcaccttactttggcgcgttagttggacgagtagccggacgaattaaa
aatggcgcatgggcaacacataaattaacgcaaaatgaaggaccacaccatatccatggg
ggacaggtcaatttcagtcaaactgtatgggacgctgaagtaaatgaagctgctgatttt
attgatattagttttacccatacgagtccagctggagacaatgggtatccaggaaattta
acagtaaaagtcatttatcaatggactgaaaaggctgtttggagtatggaaattcaagca
gaaaccgatgcaacaacattgtttaatccgacaaatcatacgtatttcaacttgagcgga
tcagttaaacgaaccattttaaaccataaactacaaattgctagcgctgtttatgctgaa
gttggagctgataaatgtccaacgggaagactatgcccagttgatggaacaccatatgat
tttcgaacgcctattttcatgagcgaagcattggcaaaacagcctactggttatgataca
ccctttaaactaactactggaaacgtgttgcttagtgaaccagaaagtggtcggcaagta
gcgattcatacgactcgagaagcagtcgtcgttttttcgacaacaggaatggatgaagaa
tatgtagtgatgggcaaaaaaatgtgcagtcacctaggaattgctctagaaactcaagag
ctgccagatgctgttcatcatccccattttcaatcaatcattctaaaaccaggagagcag
tacttttcacaaacaacctatcatttttctgcttga

DBGET integrated database retrieval system