KEGG   Carnobacterium sp. 17-4: CAR_c19480Help
Entry
CAR_c19480        CDS       T01452                                 

Gene name
gmuD1
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c19480 (gmuD1)
Enzymes [BR:crn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CAR_c19480 (gmuD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2037793..2039184)
Genome map
AA seq 463 aa AA seqDB search
MKYEFPEGFWWGSAASGPQTEGVFEGDNKGDNIWDHWYREEPEKFFNQVGPEKTSYFYEK
YKEDIQLMKETGHTTFRTSIQWSRLIPNGTGEVNQKAVEFYNDVINELLANDIEPFINLY
HFDMPMKLQEKGGWLNRETVDAYVEFAEKCFELFGDRVKKWFTHNEPIVPVEGGYLYQFH
YPNEVNMKKAVQVAYHEVLSSAKAIKVYHEMKLDGEIGIILNLTPSYPRDETNPEDVKAA
QLADAFFNRSFLDPSVKGEFPADLVELLKEIDHLPVIEEGDLEIIKNNTVDLLGVNYYQP
RRIKAKESSEKLADGPMPDDYFDNYIKPDRKMNPYRGWEIYEKGVYDILTNLRENYGNIR
CYISENGMGVEGEEAYINPDGSIEDDYRIEFVKDHLTYMHQAIQEGSNVKGYHMWTCMDN
WSWTNAYKNRYGFIAVDIENEGKRTVKKSGRWFKDVSDANGFD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgaatttccagaagggttctggtggggatctgcagctagtggaccgcaaaca
gaaggcgtttttgaaggcgataacaaaggggataatatttgggatcattggtaccgtgaa
gaaccagaaaaattctttaaccaagtaggaccagagaaaacttcttacttttatgaaaaa
tataaagaagatattcaacttatgaaagaaacaggacatacaacatttagaacttctatt
caatggagccgtttaattccgaatggcacaggagaagtcaatcaaaaagctgttgaattt
tataatgatgtaatcaatgaattgcttgcaaacgatattgaaccttttattaacttatac
cactttgatatgcctatgaaattacaagaaaaaggcggttggttaaatagagaaacagtg
gatgcttatgtagaatttgctgaaaaatgttttgagttatttggtgatcgagttaaaaaa
tggtttacacataatgaacctattgtaccggttgaaggtggatacttatatcaattccat
tatccaaatgaagtgaatatgaaaaaagctgttcaagttgcttatcatgaagtgctttca
agtgctaaagcgattaaagtttatcatgaaatgaaattagatggtgaaattgggatcatc
ctaaacttgacaccaagttatcctagagatgaaacaaatcctgaagatgtaaaagcagca
caacttgcagatgcattctttaatcgttcatttttagatccttcagttaaaggggaattc
ccagcagacttagttgaattattaaaagaaattgatcatttaccagtgattgaagaaggc
gatttagaaataatcaaaaataatacggttgatttgttaggtgttaattactaccaacct
cgtcgaatcaaagcgaaagaatcctcagaaaaactagctgatggtcctatgccagatgac
tattttgacaattacatcaaacctgatcgtaaaatgaatccataccgcggatgggagatt
tacgaaaaaggagtctatgatattctaacgaacttaagagaaaactatggcaatattcgt
tgttacatctctgaaaatggaatgggtgtagaaggagaagaagcttatattaaccctgat
ggaagtatagaagatgattaccgtattgagtttgtaaaagatcatctaacatatatgcat
caagcgattcaagaaggcagcaatgtaaaaggttaccatatgtggacatgtatggataac
tggtcatggacaaatgcttataaaaaccgatatggatttatagccgttgatattgaaaat
gaagggaaaagaacggttaagaagagtggacgttggtttaaagacgtatccgacgctaac
ggttttgactaa

DBGET integrated database retrieval system