KEGG   Carnobacterium sp. 17-4: CAR_c21150Help
Entry
CAR_c21150        CDS       T01452                                 

Gene name
nag3
Definition
beta-N-acetylglucosaminidase/beta-glucosidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
crn  Carnobacterium sp. 17-4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CAR_c21150 (nag3)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CAR_c21150 (nag3)
Enzymes [BR:crn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CAR_c21150 (nag3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2209658..2211379)
Genome map
AA seq 573 aa AA seqDB search
MGKLVDLKAKPYNLNEEQIKWVNDTIGTMTDEEKVGQLFTNLFFFGKDQFSGNDLTNKDI
LEKYHIGAARYQGGTAKEVQELINSLQKDSKIPLLVAANCDAGGNGAAKAGTYIASGAQV
EASGDTTVGYNAGYVSGREEVAMGINVNFDPCVDILQNWRNTIVNTRAYGTNADNVIKYT
NAYLEGLDQSEVIKCIKHWPGDGTEERDQHLVLGVNELSVDEWEDSFGRVYHNHIDNGVE
MIMAGHIALPEYQKALNPELQDKDILPATLAPELIQDLLKTKFGFNGLVITDATHMLGMT
ASMRREEYVPLSIAAGCDMFLFFNDIDEDFGFMLKGYQNGIITEERMKDALQRILGLKAK
LNLHKKQADGTLFQDESALEVVGCEEHLQMRADAADKGITLVKDTQNNLPISPETHKRIR
LYMLEGEKGGIYEAGSDVAQSIIDELTSRGYEVTLNDGSTRIKGKTVEYRENVDLALEVA
DIMGYSAQNNYRIQWSTAMSNEVPWFVYEVPTVFVSLNFTTHLHDATMVKTFINAYNDNE
EIIKQVIDKLEGKSEFKGTPNELVWANKWQAKL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggggaaattagtagatttaaaagcaaaaccgtataatttaaacgaggaacaaatcaaa
tgggtaaatgatactatcggaactatgacggatgaagaaaaagtgggacaattatttaca
aacttattcttctttggaaaagaccaattcagtggtaacgatttaacaaataaagatatt
ttagaaaaataccacattggggctgctcgttaccaaggtggaacagctaaagaagttcaa
gaattgattaactctttacaaaaagactcgaaaattcctttattagtagctgctaactgt
gatgcaggtggtaatggtgctgctaaagctggtacgtacattgcttctggagcacaagta
gaagcttctggggatacaactgttggatacaatgccggatacgtttctggacgtgaagaa
gttgcaatgggaatcaatgtaaactttgacccatgtgtggacattttgcaaaactggaga
aacacgattgttaatacacgtgcttacggtacaaacgctgacaatgttatcaaatacaca
aatgcttaccttgaaggtttagatcaaagtgaagtgatcaaatgtattaaacactggcct
ggtgacggtactgaagaacgtgaccaacatttagtattaggtgtgaacgaattatccgta
gacgaatgggaagattcatttggccgcgtttaccataaccacatcgacaacggtgttgaa
atgattatggctggacacattgctttaccagaataccaaaaagctttgaaccctgaacta
caagacaaagatattttaccagcaacattagcacctgaattaatccaagacttattgaaa
actaagtttggtttcaatggtttagttattacagatgctactcatatgttaggtatgaca
gcttctatgcgtcgtgaagaatacgttcctctatcgattgctgctggatgtgacatgttc
ttattcttcaatgacattgatgaagactttggtttcatgctaaaaggctaccaaaacgga
atcatcactgaagaacgtatgaaagatgctttacaacgtattttaggattgaaagctaaa
ctaaacttacacaaaaaacaagcagacggtactttattccaagacgaatctgctctagaa
gttgttggttgtgaagagcatttacaaatgcgtgctgatgcagctgataaagggatcact
ttagtgaaagatactcaaaacaacttaccaatcagtccagaaacacataaacgcattcgt
ctatacatgcttgaaggtgaaaaaggcggaatttacgaagctggatctgacgtagctcaa
tccatcatagatgaattgacttctcgtggttatgaagtaaccttaaatgacggatctact
cgtatcaaaggtaaaacggtagagtaccgtgaaaatgttgacttggcattagaagttgct
gatattatgggttacagtgcacaaaacaactaccgtatccaatggagtacagcaatgtct
aatgaagttccttggtttgtgtacgaagtgccgactgtattcgtatcattaaacttcacg
actcatttacatgatgcaacaatggtgaaaacatttatcaatgcttacaatgataacgaa
gaaattatcaaacaagtgattgacaagctagaaggcaaatcagaatttaaaggaactcca
aacgaacttgtttgggcaaacaaatggcaagctaagttataa

DBGET integrated database retrieval system