KEGG   Carnobacterium sp. 17-4: CAR_c21400Help
Entry
CAR_c21400        CDS       T01452                                 

Gene name
xpkA
Definition
xylulose-5-phosphate phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CAR_c21400 (xpkA)
Enzymes [BR:crn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     CAR_c21400 (xpkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2243136..2245493)
Genome map
AA seq 785 aa AA seqDB search
MKNYDSKDYLKKVDAFWRAANYLSVGQLYLRDNPLLQRPLKSTDVKAHPIGHWGTISGQN
FIYAHLNRVINKYDLNMFYIEGPGHGGQVMISNAYLDGSYTEIYPDITENKEGMKKLFKQ
FSSPGGVASHAAPETPGSIHEGGELGYSLSHATGAILDNPDVIAATVIGDGEAETGPLAA
GWFSNNFINPVNDGAVLPILYLNGGKISNPTILARKSNEDLKKYFEGMGWKPYFVEGTDP
EKVHPVMANTLDVVIEEIRSIQNEARKGKAEDVEMPHWPVMIIRTPKGWTGPKEWDNKKI
EGTFRAHQVPIPVDAEHMEYVNKLVDWLKSYRPEELFTENGKLIDDLKELTPKGNKRMAT
NPITNGGINAKALIIPNWKQHAIDTTIPGAVIAQDMDVFGEQARDLIVKNPNNFRIFGPD
ETKSNRLDKIFEVTNRQWLESKELTDEWQSSAGRVIDGQLSEHQAEGFLEGYVLTGRHGF
FASYESFLRVVDSMLTQHFKWLRKATDQKWRNNYPSLNVIATSTVFQQDHNGYTHQDPGI
LTHLAEKKPEFIREYLPADANSLMAVMDKTLQEEQLINLIISSKHPRPQFYSVEEAEILV
KDGLKIIDWASTDNDSEPDLVIAAAGTEPNLEALAAMSILHKAFPELKIRFINIVDILKL
RHPDIDSRGLTDEKFDSYFTKEQPIIFAFHGFEGLIRDIFFNRHNHNLRIHGYRENGDIT
TPFDMRVLNEMDRFHLAKDAAKAVYGLKANKFMQEMENTVNFHHQYIRENGIDIPEVINW
KWEKI
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattatgattctaaagattatttgaaaaaagttgatgctttctggcgtgcagcc
aattatctctctgttggccaattatatctaagagataatcctttgctgcaaaggcccctc
aaatcaactgatgtgaaagcgcatccgattggacattggggaacgatttctggccaaaac
tttatttatgctcacttaaatcgcgttattaataaatatgacttgaacatgttctatatc
gaaggtcctggtcatggcggtcaagtaatgatatctaatgcttacctagacggtagttat
actgagatttatcctgatattactgaaaataaagaaggaatgaaaaaactattcaaacaa
ttttcatctcctgggggagttgcttctcatgctgctccagaaacaccgggttctatccat
gaaggaggcgaacttggttactctctatcacatgcaacgggtgctattttagataaccct
gatgtaattgctgcgacagttattggtgacggagaagctgaaactggtccattagcagct
ggttggttctctaataattttattaatccagtcaatgatggtgctgtactaccgattctt
tacttaaatggtggtaaaatttcaaatccaacgattttagcacgtaagagtaatgaagat
ttaaaaaaatattttgaaggtatgggatggaaaccttattttgttgaaggtactgatcct
gaaaaagttcatcctgtcatggctaatactttagatgttgtaattgaagaaatcaggtca
atccaaaatgaagcccgtaaaggtaaggccgaagatgtggagatgcctcattggccagtc
atgattattcgtacaccaaagggatggactggtccaaaagaatgggacaataaaaaaatt
gaaggaacatttcgtgcccatcaagtgccgattcctgtggatgctgagcatatggaatat
gtcaataaactggttgattggttgaaatcgtatcgtccagaagagttatttactgaaaat
ggtaaattaattgatgatttaaaagaacttacaccaaaaggaaataaacggatggcaaca
aatccaatcacaaacggaggaataaatgctaaagccttgattattcctaattggaaacag
catgcaatcgatacaactatacctggtgcagtaatagcgcaagatatggatgtctttggt
gaacaagctcgcgatttaatcgtaaagaatcctaataatttccgtatttttggtcctgat
gaaactaaatcaaaccgtttggataaaatctttgaagtaactaatcgtcagtggttagaa
tctaaagagctaactgatgaatggcaatcttcagctggccgggttatcgatggacaactt
tctgaacatcaagctgagggatttctggaaggctatgtattaacaggacgtcatggcttc
tttgcaagctatgagtcattcttacgtgtagttgattcaatgttgactcaacactttaaa
tggttacgtaaagcaacagaccagaaatggagaaataactatccatcgttgaatgtaatt
gctacatcaactgtgtttcaacaagaccacaatggttatactcaccaagatccaggtata
ttaacacatttagctgagaaaaaacctgaatttattcgtgaatatttaccagctgatgct
aacagtttaatggcagttatggacaaaaccttacaggaagaacaattaatcaatttgatt
atttcaagtaaacatccaagaccacaattctattcagttgaagaagcagaaatattagtt
aaagatggtcttaaaattattgattgggcatcaacagataatgatagtgaaccagattta
gtaatagcagcagctggaacagaacctaatttagaagccttagcagcgatgtctatcttg
cacaaagcttttcctgagttaaagattcgttttatcaatattgtagatattctaaaatta
cgtcatcctgatattgattctcgtgggttgactgatgaaaaatttgatagttactttaca
aaagaacaacctataatttttgccttccatggttttgaaggtctgattcgtgatattttt
ttcaatcgtcacaatcacaatctacgtattcatgggtatcgtgaaaatggcgatatcaca
acaccatttgatatgcgtgttttaaatgaaatggatcgcttccacttagcaaaagatgca
gctaaggcagtttatggattgaaagctaataaatttatgcaagaaatggagaatacggtg
aatttccaccaccaatatattcgcgaaaatggtatagatatacctgaagttataaattgg
aaatgggaaaaaatctaa

DBGET integrated database retrieval system