KEGG   Carnobacterium sp. 17-4: CAR_c21410Help
Entry
CAR_c21410        CDS       T01452                                 

Gene name
xylA1
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:crn00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:crn00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2245832..2247142)
Genome map
AA seq 436 aa AA seqDB search
MTYFPAINKIQYEGPESTNPFAFRYYNPEEVVLGKTMKEQLRFSVAYWHTFTDDGSDPFG
KGVNQRDWLTDDPMETAKNRVEASFEFFGKLGVEYFCFHDMDVAPFGESLEDFFANLDTI
TNLIQEKMDQTGIKLLWNTADRHSNPIYVHGAASSSNADVYAVSAAQVKKGIDISKKLGG
KNFVFWGGREGYENLINTNMKLEEENIARLYHMAIDYSNKIGHEELVFLLEPKPKEPMKH
QYDFDAATSMAFLQKYDLTDRFKLNLEANHATLAGHTFEHEMNVARNYNALGSLDANQGD
MLLGWDTDEFPTDVYSVTLAMVEFLENGGIEPGGINFDAKVRRTSFEMEDLFLAHIAGMD
TFARGLKAAAKIKETRFLDELKEKRYASYETGIGSDILSGKADLETLTSYALEHNDVKNE
SSHIEYIKSKLNDYLV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacatattttccagcgattaataaaattcaatacgaaggaccagaatcaacaaatcct
ttcgcattccgttattacaatccggaagaagtagtactaggaaaaactatgaaagaacaa
ttgcgtttctcagtagcttattggcatacatttacagatgatgggtcagatccttttggt
aaaggcgtcaatcaaagagattggttaacggatgacccaatggaaacggcaaaaaacaga
gtagaagcatcgtttgaattttttggaaaattaggagttgagtatttctgttttcatgat
atggatgttgcaccttttggagaatcactagaagatttttttgctaacttggatacaatt
actaatcttattcaagaaaaaatggatcaaacaggaatcaaattgttatggaatacagct
gacagacattctaatccaatttatgtacatggtgctgcttcaagctctaatgcagatgtt
tacgctgtgtcagctgcacaagtgaaaaaagggattgatatcagtaaaaagttaggcgga
aaaaatttcgttttctggggtggacgtgaaggttacgaaaatctaatcaatacaaatatg
aaattagaagaagaaaatattgctcgtctttaccatatggcaattgattattcaaataaa
attggtcatgaagagctagtgttcttactagaacctaaaccaaaagaaccaatgaaacac
caatacgattttgatgcagcaacaagtatggcattcttacaaaaatacgatttaactgat
cgtttcaaattgaatttagaagcaaaccatgcaactttggctggtcatacatttgaacac
gaaatgaatgtagctcgtaactacaacgctttaggatcacttgatgcgaaccaaggagat
atgcttttaggatgggatacagatgaattcccaacagatgtttattcagtaaccttagct
atggttgaatttttagaaaacggcggaattgaacctggaggaatcaactttgacgcaaaa
gtacgccgaacatcatttgaaatggaagatttattcttagcacatattgcaggaatggat
acttttgctagaggattaaaagcagctgctaaaataaaagaaacgcgcttcttagatgaa
ctaaaagaaaaacgttatgcaagttatgaaacaggtattggttcagatattctatctggg
aaagcagatttagaaacattgacaagttatgcattagaacataatgacgttaaaaatgaa
tcatctcatattgagtatattaaatcgaaattaaatgactacttggtttag

DBGET integrated database retrieval system