KEGG   Carnobacterium sp. 17-4: CAR_c21410Help
Entry
CAR_c21410        CDS       T01452                                 

Gene name
xylA1
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CAR_c21410 (xylA1)
   00051 Fructose and mannose metabolism
    CAR_c21410 (xylA1)
Enzymes [BR:crn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CAR_c21410 (xylA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2245832..2247142)
Genome map
AA seq 436 aa AA seqDB search
MTYFPAINKIQYEGPESTNPFAFRYYNPEEVVLGKTMKEQLRFSVAYWHTFTDDGSDPFG
KGVNQRDWLTDDPMETAKNRVEASFEFFGKLGVEYFCFHDMDVAPFGESLEDFFANLDTI
TNLIQEKMDQTGIKLLWNTADRHSNPIYVHGAASSSNADVYAVSAAQVKKGIDISKKLGG
KNFVFWGGREGYENLINTNMKLEEENIARLYHMAIDYSNKIGHEELVFLLEPKPKEPMKH
QYDFDAATSMAFLQKYDLTDRFKLNLEANHATLAGHTFEHEMNVARNYNALGSLDANQGD
MLLGWDTDEFPTDVYSVTLAMVEFLENGGIEPGGINFDAKVRRTSFEMEDLFLAHIAGMD
TFARGLKAAAKIKETRFLDELKEKRYASYETGIGSDILSGKADLETLTSYALEHNDVKNE
SSHIEYIKSKLNDYLV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacatattttccagcgattaataaaattcaatacgaaggaccagaatcaacaaatcct
ttcgcattccgttattacaatccggaagaagtagtactaggaaaaactatgaaagaacaa
ttgcgtttctcagtagcttattggcatacatttacagatgatgggtcagatccttttggt
aaaggcgtcaatcaaagagattggttaacggatgacccaatggaaacggcaaaaaacaga
gtagaagcatcgtttgaattttttggaaaattaggagttgagtatttctgttttcatgat
atggatgttgcaccttttggagaatcactagaagatttttttgctaacttggatacaatt
actaatcttattcaagaaaaaatggatcaaacaggaatcaaattgttatggaatacagct
gacagacattctaatccaatttatgtacatggtgctgcttcaagctctaatgcagatgtt
tacgctgtgtcagctgcacaagtgaaaaaagggattgatatcagtaaaaagttaggcgga
aaaaatttcgttttctggggtggacgtgaaggttacgaaaatctaatcaatacaaatatg
aaattagaagaagaaaatattgctcgtctttaccatatggcaattgattattcaaataaa
attggtcatgaagagctagtgttcttactagaacctaaaccaaaagaaccaatgaaacac
caatacgattttgatgcagcaacaagtatggcattcttacaaaaatacgatttaactgat
cgtttcaaattgaatttagaagcaaaccatgcaactttggctggtcatacatttgaacac
gaaatgaatgtagctcgtaactacaacgctttaggatcacttgatgcgaaccaaggagat
atgcttttaggatgggatacagatgaattcccaacagatgtttattcagtaaccttagct
atggttgaatttttagaaaacggcggaattgaacctggaggaatcaactttgacgcaaaa
gtacgccgaacatcatttgaaatggaagatttattcttagcacatattgcaggaatggat
acttttgctagaggattaaaagcagctgctaaaataaaagaaacgcgcttcttagatgaa
ctaaaagaaaaacgttatgcaagttatgaaacaggtattggttcagatattctatctggg
aaagcagatttagaaacattgacaagttatgcattagaacataatgacgttaaaaatgaa
tcatctcatattgagtatattaaatcgaaattaaatgactacttggtttag

DBGET integrated database retrieval system