KEGG   Carnobacterium sp. 17-4: CAR_c21420Help
Entry
CAR_c21420        CDS       T01452                                 

Gene name
galM2
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
crn  Carnobacterium sp. 17-4
Pathway
crn00010  Glycolysis / Gluconeogenesis
crn00052  Galactose metabolism
crn01100  Metabolic pathways
crn01110  Biosynthesis of secondary metabolites
crn01120  Microbial metabolism in diverse environments
crn01130  Biosynthesis of antibiotics
Module
crn_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c21420 (galM2)
   00052 Galactose metabolism
    CAR_c21420 (galM2)
Enzymes [BR:crn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CAR_c21420 (galM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Zona_pellucida
Motif
Other DBs
NCBI-ProteinID: AEB30799
UniProt: F4BPL9
Position
complement(2248445..2249479)
Genome map
AA seq 344 aa AA seqDB search
MDIKIQTVNSKWKLFSLINDKGMEVQFLNYGGIITKILVPDKNSNIANIVLGYPDYKDYE
SDQNFFGAIIGPVAGRIEGAEFPLDEEKFNLEKNDGNHHLHGGTDSFHRIVWKSESFKTD
HSVGVTLSYLRKDGENGYPGNLDVSVTYTLTNNNQFIIDYWATTDKKTPVTLTNHSYFNL
SGNLDSTIHNHRLFIDSCKFLELDKELIPTGKIKDAINTNFDLRNGRRISEGITSQTAQN
KIVGNGYDHYFIFDNDKKENVVVKEEMSGRILKIKTNQPGMVLYTGQNLIEGLELSGGTS
KKYSGVCFETQSSAALLHHRELPSIILEAGETYEKQTLFSFDIE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggatataaaaattcagacagtgaatagtaaatggaaactattcagccttatcaatgat
aaaggaatggaagtacaatttttaaactatggtggaataatcacaaaaattttagttcca
gataagaatagcaacatagcaaatattgttttaggctatccagactacaaagattatgag
tcagatcaaaatttctttggtgcaataattggtcccgttgcaggcaggattgaaggagct
gaatttccgcttgatgaagaaaaatttaatttggaaaagaatgatggcaaccatcattta
catggtggaacagattcattccatcgtattgtatggaagtctgaaagttttaaaacagat
catagtgtaggtgtgactctaagctatttaagaaaagatggagaaaatggttatccagga
aatttggatgtatcggttacgtatacactgacgaataataaccaatttataattgattat
tgggcaactacagataaaaaaactccagtaacgttaacgaaccattcctattttaattta
tcaggaaatctagatagtactatccataatcatcgattattcatagatagttgcaaattt
cttgagcttgataaggaactaatccctaccggtaaaataaaggatgcaataaatacaaac
tttgatcttagaaatggaagacgaattagtgagggaataacctctcaaacagcgcaaaat
aaaattgtgggtaacggttatgatcattactttatattcgataatgataaaaaagagaat
gttgttgttaaagaagaaatgagcggtagaattcttaagattaaaactaatcaacctggt
atggttttatatacaggccagaatttaatagagggtcttgaattatcgggaggtacatca
aaaaaatattcaggagtgtgttttgagacacaatcatcggcagcattgttacatcatcga
gagttaccatcaatcatattagaggctggcgaaacatatgaaaaacaaacattattttca
tttgatatagaataa

DBGET integrated database retrieval system