KEGG   Carnobacterium sp. 17-4: CAR_c21750Help
Entry
CAR_c21750        CDS       T01452                                 

Gene name
bgaC
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CAR_c21750 (bgaC)
Enzymes [BR:crn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CAR_c21750 (bgaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2288352..2290121)
Genome map
AA seq 589 aa AA seqDB search
MNTFEIKEDFLLNGEPFKITSGAVHYFRVLPEDWYHSLYNLKALGFNTVETYIPWNVHEP
KEGEYQFSGQWDIKKFVQLAEELGLFVILRPSPYICAEWEFGGLPAWLLTYKDMLIRSSD
PVFIEKVSRYYKELLKQITPLQVDHGGPVIMMQLENEYGSYGEDKEYLRTLYELMLKLGV
TIPIFTSDGAWRATQEAGTMTDLDILTTGNFGSRSKENFKELKEFHESKGKKWPLMCMEY
WDGWFNRWNDPIIKRDALELTQDVKEALEIGSLNLYMFHGGTNFGFMNGCSARLRKDLPQ
VTSYDYDAPLNEQGNPTEKYFALKNMMQESFPDIEQHPPLVKDSMSITNIQVGGKVSLLS
IVDRIAKKQESRYPKTMEELGQQYGYTLYRSYVKKDSDEEFYRVIDGSDRLHFFLNEEKI
ATQYQEEIGEKIYASPISGSNQLDVLVENMGRVNYGHKLLADTQQKGIRRGVMSDLHFIT
NWEQYSLDFSEPLSIDFDKEWKENSPSFYQYKVTIDAPEDTFINMELFGKGIVLVNGFNI
GRFWNVGPTLSLYAPMSLFRKGENEIIVFETEGIWSKSISLEKEPKFKK
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatttgaaataaaagaagattttttactaaacggtgagccattcaagataaca
tctggtgctgttcactatttccgagttcttcctgaggactggtatcattcattatataat
ttaaaagctcttggctttaatacagtcgaaacgtatattccttggaatgtacacgagccg
aaagaaggagaatatcaattttctggtcagtgggatataaaaaaatttgtccaactagca
gaggagttaggtttattcgttattcttcgcccatcaccttatatttgtgcagaatgggaa
ttcggtggattgccagcatggctactaacgtataaagatatgcttatacgttcttctgat
ccagtatttattgaaaaagtttctcgctactataaagagcttcttaaacaaattacgcct
cttcaggtggatcatggtggtccagtcattatgatgcagttagaaaatgaatacggttca
tatggtgaagataaagaatatttgagaacgctttatgagttgatgttgaaactaggcgta
accattcctatttttacttcagacggagcatggagagctacgcaagaagccggaacgatg
acggatctagatattctgactacaggaaatttcggttctcgttcaaaagaaaactttaag
gaattaaaagaatttcatgaatcaaaagggaaaaaatggcctttgatgtgtatggagtat
tgggatggttggtttaatcggtggaatgacccaattataaaaagagatgccctagagtta
actcaggatgtaaaggaagctttagagattggtagcttaaatctttatatgttccatgga
ggaacgaactttggctttatgaatggttgttcagcacgattacgaaaagatcttccgcaa
gtcacgtcatatgattatgacgcacctttaaatgaacaaggtaatccaactgaaaaatat
tttgctttaaaaaatatgatgcaagaaagttttccggatattgaacaacaccctccattg
gtgaaagatagtatgagcattacgaatattcaggttggtggaaaggtaagtctactctct
attgttgatcggatcgctaaaaaacaagaatctagatatccaaaaacaatggaagaacta
ggacaacaatatgggtatacactatatagaagttatgtgaaaaaagatagtgatgaagaa
ttttatcgtgtaatagatggcagcgaccgtcttcattttttccttaacgaagaaaaaata
gctacacagtaccaagaagagattggagaaaagatatacgcttcacctatctctggttct
aatcagcttgatgtactagtagaaaatatgggacgtgtcaattatggacacaagctattg
gctgatacacaacaaaaagggattcgaagaggggtcatgtctgatttacactttatcacc
aattgggagcaatacagcttagatttttcagaaccgttgtctattgactttgataaggaa
tggaaagagaattctccatcgttttaccagtataaagtgactattgatgcaccagaagat
acatttattaatatggagttgtttggcaaaggaatcgttctagtaaatgggtttaacatt
ggacgattttggaatgtagggccaactctatcactatatgctccaatgtctctctttaga
aagggagaaaacgaaattattgtttttgaaacagaaggaatctggtcaaaatcaataagt
ttagaaaaggaaccaaaatttaaaaaatag

DBGET integrated database retrieval system