KEGG   Carnobacterium sp. 17-4: CAR_c21810Help
Entry
CAR_c21810        CDS       T01452                                 

Gene name
yoxA
Definition
putative epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c21810 (yoxA)
   00052 Galactose metabolism
    CAR_c21810 (yoxA)
Enzymes [BR:crn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CAR_c21810 (yoxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2295528..2296484
Genome map
AA seq 318 aa AA seqDB search
MTYGAAVTAIRVPDKNGLLQNIVLGYDMVDEYVSHRPFYGATVGRVAGRIDKGKFTLEGK
NYQLETNEKGNHLHGGENSLDTKIWTVKTNSTENEAQLIFSYKSLNNENGYPGNLAIQVT
YTLTESNDWKVNYHATTDEATLFNPTNHVYFNLTGNPTHTIKQHQLTLTSNLFAELREDS
IPTGNLLPVNKTPFDFTTADTINKGFESSHPQNKLVSGYDHPFILEHQSQKPEAVLYDPI
SGRRVQMFTDQDAVVIYATDSLDGKHTKEGTLIEHYAGITLETQQLPDAINQVNFGNIIL
QPTDIFQAETTYHFDTML
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacctatggcgcggcagtaacagctattcgagtgcctgataaaaatggccttttacag
aacatcgtactcggctatgatatggtagatgagtacgtatctcatcgccctttttatggt
gcaacagttggaagagttgccggaaggattgataaaggtaagtttacattggaaggaaaa
aactaccaactcgaaacaaatgaaaaaggcaatcatttgcatggcggagaaaatagtttg
gatacaaaaatttggacagtaaaaactaattccactgaaaatgaagctcaattgattttc
tcatacaagagtctcaacaatgaaaatgggtatcctggcaacttagcaatacaagtgacg
tatacattgacggaatcaaacgattggaaagtcaattatcatgccacaactgatgaagcc
accttgtttaatccgactaatcacgtctactttaatttaacaggtaacccaacgcacaca
atcaaacagcatcaattaaccttaacgagtaatctgttcgctgaactcagagaggattct
attccgaccggaaacttgttgcctgtcaataaaacaccgttcgatttcacaacagcagac
acaataaacaaagggtttgagagttcacatcctcaaaataaattagtatctggatatgat
catccatttattcttgaacaccaatcccaaaaaccggaagctgttttgtatgacccaatt
agtggcagacgcgtacagatgtttacagatcaagacgccgttgtcatttatgcgacggac
tcattagatggaaaacatacaaaagaaggaacattaattgaacactatgcaggtatcact
ttagaaactcaacaactaccggacgcgatcaaccaagtaaatttcggaaatatcatcctt
caaccaactgacatttttcaagctgaaacaacttaccactttgatacaatgctataa

DBGET integrated database retrieval system