KEGG   Carnobacterium sp. 17-4: CAR_c22170Help
Entry
CAR_c22170        CDS       T01452                                 

Definition
phosphoglycerate mutase family protein (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAR_c22170
   01230 Biosynthesis of amino acids
    CAR_c22170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c22170
  Energy metabolism
   00680 Methane metabolism
    CAR_c22170
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAR_c22170
Enzymes [BR:crn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CAR_c22170
Exosome [BR:crn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CAR_c22170
  Exosomal proteins of melanoma cells
   CAR_c22170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2331680..2332300)
Genome map
AA seq 206 aa AA seqDB search
MRDIYFVRHAESDIRVHDEFSRPLTEKGIQDSALVTNYLKDKNIQCIYSSPYVRAVDTVK
DLSEMLAIDVTCIDDFRERGISSWIEDFNTFSQRQWNDFDYRLSDGECLREVQLRNVKAL
MELVQLHPEANCIIGSHGTALSTIVNHFDPHFGFEDFSKIKGLMPWIVKITFKNQISIKI
ESIDVFKNNEITTISLSESILTDNFK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgagagatatttattttgttcggcatgctgagtcagatattagagttcatgatgagttt
tcaagaccgttaactgaaaaaggtatacaagatagtgcgttagttaccaattatttgaaa
gataagaatattcaatgcatctattctagtccgtatgtcagagcagttgatacagttaaa
gatttatctgaaatgcttgctattgatgtaacgtgcattgatgactttagggaacgcggt
atttctagttggattgaggacttcaatacttttagtcagcgacaatggaatgattttgac
tatagattgtctgatggagaatgtctaagagaagttcaattaagaaatgtaaaggcgtta
atggaactagtacagttacatccggaagcaaattgtatcattgggagtcatggaacggct
ctaagtacaattgtcaatcattttgatcctcattttggtttcgaagacttttcaaaaata
aaagggttaatgccttggattgtaaaaattacgttcaaaaatcagatttctataaaaata
gagtcaattgatgtgtttaagaataatgagatcacaactatcagtttgagtgaatctatt
ttgacggataattttaaatga

DBGET integrated database retrieval system