KEGG   Carnobacterium sp. 17-4: CAR_c24780Help
Entry
CAR_c24780        CDS       T01452                                 

Gene name
gltX
Definition
glutamate--tRNA ligase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:crn00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2585191..2586660)
Genome map
AA seq 489 aa AA seqDB search
MTKKVRVRYAPSPTGHLHIGNARTALFNYLFARHNGGDFIIRIEDTDLKRNIEGGEASQL
ENLKWLGMNWDESPDNPGEFGPYRQSERREIYDPLVEQLLLSNRAYKCYCSEEELEEERE
AQRARGEMPHYSGKCANLTAKEQKEKEATGIEPVIRYRVIKENTYNFEDIVKGHISFEAE
SIGGDFVIVKRDGMPTYNFAVSVDDHFMEITHVLRGDDHIANTPKQLMIYEAFGWEAPQF
GHMTLIINSETGKKLSKRDGNILQFIEQYRELGYLPEAMFNFISLLGWSPVGEEEIFDHN
TFVEMFDPARLSKSPAAFDAKKLEWINNQYMKQADLETVTALALPHLIKAGYVEENASPE
KLEWVQKVVSLYHEQMSYGAEIVELSSLFFSDEPAIDSVAKEVLEGETVSEVLKAFSKQL
DEITPFDADEIKKAIKTVQKETGIKGKNLFMPIRVAVTGQSHGPEIGPTIELLGREKAQA
HLQAALAKL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaagttcgagtacgctatgcgccaagcccaacaggacatctacatattggg
aatgctcgtacagcattattcaattatttatttgcacgacacaatggtggagactttatc
atccgtattgaagatactgatttaaaacgcaacattgaaggtggagaagctagccagtta
gaaaacttgaaatggttagggatgaattgggatgaaagtccggataatccaggagaattt
ggtccttatcgccaatctgaacgtagagaaatttatgatccattagttgaacaattattg
ctaagcaatcgtgcgtacaaatgttactgttcagaagaagagttagaagaagaacgtgaa
gcacaaagagctagaggagaaatgcctcattacagcgggaaatgtgcaaacctaacagct
aaggaacaaaaagaaaaagaagcaacaggcattgagccagttattcgttaccgtgtgatt
aaagaaaacacgtacaattttgaagatatcgtaaaaggccacatttcatttgaagcagaa
agtattggcggagatttcgtgattgtaaaacgtgacggtatgccgacgtataactttgca
gtgtctgtagacgatcactttatggaaattacacatgtgttgcgtggagatgaccatatt
gcgaatacaccaaaacaattaatgatctatgaagcatttggatgggaagctcctcaattt
ggacatatgacactaattatcaacagtgaaacaggtaaaaaattaagcaaacgtgatggc
aacattcttcaatttattgagcaataccgcgaattaggctacttgccagaagctatgttt
aactttatttctttattaggatggtcgcctgtaggagaagaagagatctttgatcataat
acatttgttgaaatgttcgatcctgcacgtttaagcaaatcaccagcggcatttgatgct
aaaaaattagaatggatcaataatcaatacatgaagcaagctgatttagaaacagtaaca
gcattagctttaccacatttgatcaaagctgggtatgttgaagaaaacgcatcaccagag
aaattggaatgggttcaaaaagttgttagcttataccatgagcaaatgagttatggggca
gaaattgttgaactatcaagtttgttctttagtgatgaacccgcaatcgatagtgtagca
aaagaagttttagaaggtgaaacagtttcagaagttttaaaagctttctctaaacaatta
gatgaaattacgccttttgatgcagatgaaatcaaaaaagcgattaaaacagtacaaaaa
gaaaccggaattaaagggaaaaatctctttatgcctattcgagtagctgtaacaggacaa
tcacatggaccagaaattggaccaacgatcgaactacttggccgcgaaaaagctcaagca
catctacaagcagcattagcaaaactataa

DBGET integrated database retrieval system