KEGG   Citrobacter rodentium: ROD_01461Help
Entry
ROD_01461         CDS       T01145                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cro  Citrobacter rodentium
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cro00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(173228..173707)
Genome map
AA seq 159 aa AA seqDB search
MTPAYIAIGSNLASPLEQVNAAITALGDIPHSRIIAVSSFYRTPPLGPQDQPDYLNAAVA
LETDLEPEALLDHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDRIINSERLTVPHYDMH
NRGFMLWPLFEIAPDLRFPQGESLQHLLAGLGAGKPDRW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccggcgtatatcgccatcggcagcaatctggcctcgccgctggagcaggttaat
gcggcgataacagcgcttggcgatattccacacagccggattatcgccgtctcctccttt
taccgcacgccgccgctgggaccgcaggatcagcctgattacctcaacgcggcggtcgcg
ctggaaaccgacctcgaaccggaagcgctactcgaccacactcagcgcatcgaactacaa
cagggccgggtgcgcaaagccgaacgctgggggccgcgcacgctggatctcgatattatg
ctgtttggcgatcgcatcattaacagcgagcggctgaccgtaccacattacgacatgcat
aaccgcggctttatgctctggccgctgtttgaaatcgccccggatctgcgttttccgcag
ggcgaatccctgcaacatctccttgccggactcggcgccggaaagcccgatcgctggtaa

DBGET integrated database retrieval system