KEGG   Citrobacter rodentium: ROD_01761Help
Entry
ROD_01761         CDS       T01145                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cro  Citrobacter rodentium
Pathway
cro00900  Terpenoid backbone biosynthesis
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01130  Biosynthesis of antibiotics
Module
cro_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ROD_01761 (dxr)
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ROD_01761 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: CBG86956
UniProt: D2TI60
Position
208854..210050
Genome map
AA seq 398 aa AA seqDB search
MKHITILGSTGSIGCSTLDVVRQNPGDYRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEA
SAKLLKNTLQQHGSRTDVLSGQQAACEMAALDEVDQVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMEAVKHSKARLLPVDSEHNAIFQSMPQPIQHNLGYADLEQNGVMS
VLLTGSGGPFRETPLRDLASMTPDRACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGVKPLDFC
KLSALTFSAPDYQRYPCLKLAMEAFEQGQAATTALNAANEIVVAAFLAEDIRFTDIADLN
LGVLEQMELQEPQSVDDVLRVDAIAREVARKQVMRLAS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatataaccattctgggctcgaccggatcgattggctgcagcacgctcgatgtg
gtgcgccagaatcccggcgactatcgcgtggtcgcgctggtcgcaggcaaaaatgtcacc
cgtatggtggagcagtgtctggaattctctccgcgctatgcggtgatggatgatgaagcc
agcgcgaaacttctgaaaaatacgctgcaacagcacggtagccgcaccgatgttctcagc
ggtcagcaggccgcctgtgagatggccgcgctggatgaagtcgaccaggtaatggccgct
attgtcggcgccgccgggctgttaccgacgcttgccgccattcgtgccggaaaaaccatc
ctgctggcgaacaaagagtcgctggtcacctgtggacgcctgtttatggaggcggtgaag
cacagcaaggcccgcctgttaccggtggacagcgagcataacgccatttttcagagtatg
ccccaacccattcagcacaatctgggatacgctgacctggagcagaatggcgtaatgtcc
gttttgcttaccgggtctggtggcccgttccgcgagacgccgctgcgcgatctggcgtcg
atgacgcccgatcgggcttgtcgtcacccgaactggtcgatggggcgtaagatttccgtc
gattctgccaccatgatgaataaaggtctggaatacattgaggcgcgctggttgtttaac
gccagcgccagccagatggaagtgctgattcatccgcagtcggtgatccactcgatggtg
cgttatcaggacggcagcgtcctggcgcaactcggagaaccggatatgcgtacgcctatc
gcccataccatggcctggccgaatcgcgtgacctccggcgtgaagccgcttgatttctgc
aagctgagcgcgctgacctttagcgcgcctgactaccagcgttatccgtgcctgaagctg
gcgatggaggcatttgagcaggggcaggcggcaaccacggcgctgaacgcggccaacgaa
attgtcgtggctgcgtttctggctgaagacattcgctttaccgatatcgccgatctcaat
ttaggcgtgctggagcagatggaactgcaggaacctcagagcgtggacgatgtgctgagg
gtcgacgccattgcgcgagaagtcgccagaaaacaagtgatgcgactcgcaagctga

DBGET integrated database retrieval system