KEGG   Citrobacter rodentium: ROD_03991Help
Entry
ROD_03991         CDS       T01145                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cro  Citrobacter rodentium
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cro00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cro00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(446038..449121)
Genome map
AA seq 1027 aa AA seqDB search
MNLNTDSLAAVLARRDWENPGVTQLNRLEAHPPFSSWRNADDARACRDATHKRSLNGEWR
FAWFPSPEAVPESWLTDDLQQADSVQLPSNWQMYGYDAPIYTNVTYPIPVNPPFVPSDNP
TGCYSLTFTVDDAWLREGQTRIIFDGVNSAFHLWCNGRWIGYGQDSRLPSEFDLSAFLTS
GENRLAVMVLRWCDGTYLEDQDMWRMSGIFRDVTLLHKPLTQISDLRIATHFNDDFSRAE
LAAEVRLRGELCDELRVTVQLWDGETQVGECTAPLGSEIIDERGAWHDRVSLRLKVDKPS
LWSAETPWLYRAVALLHTADGTLIEAEACDVGFREVKIENGLLLLNGKPLLIRGANRHEH
HPQNGQVMDEATMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MTPMNRLSDDPDWLPAMSQRVTRMVQRDRNHPAIIIWSLGNESGHGANHDALYRWLKAED
PSRPVQYEGGGANSAATDIICPMYARVDQDQPFPAVPKWSIKKWLSMPGEQRPLILCEYA
HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDR
QFCMDGLVFADRTPHPSLYEAKHAQQFFQFTLLPGDGMRIEVASEYLFRHSDNEILHWSI
TLDGNPVAAGEAALDIAPQGRQLIALPDIAAPDAAGQLWLTVRVEQPQATAWSPAGHISA
WQQWPLAEKLSVTIPPRAAAAPQLKVENAAFEVVVNQQRWQFCRQRGTLSQYWIADAAQL
LTPLTDQFTRAPLDNDIGISEVTRIDPNAWVERWKAAGHYRAEAQLLQCEAETLSNAVLI
TTAHAWQYQGETLFVSRKIWRIDGQGELTITVDVDVASGTPHPARVGLSCQLAQVAERVN
WLGLGPHENYPDRLSAACFDRWDLPLAEMYTPYVFPSENGLRCGTRELCYGAHRWRGDFQ
FNISRYSQKQLMETSHRHLLREENGTWLNIDGYHMGVGGDDSWSPSVSPEYQLSAGRYHY
QIVWGQK
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcaatactgattcactggccgccgtactggcccgtcgcgactgggaaaatccc
ggcgtcacgcagctcaatcgcctggaggcgcacccgccgttcagcagctggcgcaatgcc
gacgatgcccgcgcctgccgggacgctacgcacaaacgcagcctgaacggcgaatggcga
tttgcctggtttccgtcgccggaagcggtaccggagagctggctgactgacgatctgcaa
caggcggacagcgtgcagctcccctccaactggcagatgtacggttacgacgcgccgatc
tataccaacgtcacctaccccatcccggtaaacccgccttttgtgccgtcagacaatccc
accggctgttactcgctcacattcaccgttgacgacgcctggctgcgggaaggccagacg
cgaatcatttttgacggcgtgaactcggcgtttcatttatggtgcaacggacgctggatc
ggctacggccaggacagccgactgccctctgaattcgatctcagcgcttttctgacgagc
ggcgaaaaccgtctggcggtgatggtgctgcgctggtgcgacggcacgtatctggaagat
caggacatgtggcgaatgagcggcattttccgcgacgtcaccctcctgcataaaccgctt
acgcaaatcagcgatctgcggattgccacccactttaacgatgatttcagccgcgcggag
ctggccgccgaagtcagactgcgcggcgagctgtgtgacgagctgcgcgtgaccgtgcag
ctgtgggacggcgaaacgcaggtcggtgaatgcaccgccccgttgggcagcgagattatt
gacgaacgcggcgcctggcatgaccgcgtctccctgcgcctgaaggtcgataagccgtcg
ctgtggagcgctgaaacgccctggctgtaccgcgcggtggcgctgctgcacactgccgac
ggcacgctgattgaagcggaggcctgcgacgttggcttccgcgaggtcaaaattgaaaat
ggcctgctgttgctcaacggcaagccgctgctgattcgcggcgctaaccgccatgagcac
catccgcaaaacggtcaggtgatggacgaagcgacgatggtgcaggacattctgctgatg
aagcagaataactttaacgccgtgcgctgttcccattacccgaaccatccgctgtggtac
accctctgcgaccgctacggcctgtacgtggtagacgaagccaatattgaaacccacggc
atgacgccgatgaaccgcctcagcgacgatccggactggctgcccgccatgagccagcgg
gtgacgcgcatggtacagcgcgaccgtaatcatccggccattattatctggtcgctgggc
aatgagtccggtcacggcgcgaatcacgacgcgctctaccgctggctgaaggcggaagat
ccgtcacgcccggtgcagtacgaaggcggcggcgcaaacagcgcggcgacggatatcatc
tgcccgatgtatgcccgagtcgatcaggatcagccgttcccggcggtgccaaaatggtcg
atcaaaaaatggctgtcgatgccgggcgagcagcgcccgctgatcctgtgtgaatacgcc
cacgcgatgggcaacagcctcggcggattcgccaaatactggcaggcgtttcgtcagtat
ccgcgtctgcagggcggctttgtctgggactgggtcgatcagtcgctgattaagtacgat
gaaaacggcaacccgtggtcggcctacggcggcgactttggcgatacgccgaacgatcgc
cagttctgcatggacggcctggtgtttgccgaccgcacgccgcacccctcgctgtatgaa
gcgaaacacgcgcagcagtttttccagtttaccctgctgccgggcgacgggatgcgcatt
gaggtcgccagcgaatatctgttccgccacagcgacaatgagatcctgcactggtccatc
accctggacggcaacccggttgccgccggtgaagcggcgctggatatcgcaccgcaggga
cgccagcttatcgccctgcccgacattgccgctcccgacgccgcgggccagctgtggctg
acggtgcgcgtggagcagccgcaggcgaccgcgtggtcgcccgccggacacatcagcgcc
tggcagcagtggccgcttgcggaaaaactcagcgtaaccatcccgccgcgcgccgccgcc
gcgccgcagctgaaggttgaaaacgcagcctttgaggtcgttgtgaatcagcagcgctgg
cagttctgccgccagcggggcacgttgtcgcagtactggattgcggacgcagcgcagctt
ctcaccccgctcaccgaccagttcacccgcgcgccgctggataacgacatcggcatcagc
gaagtcacccgtatcgatcccaacgcctgggtcgagcgctggaaggctgccggacactac
cgcgcagaagcacagctgttgcagtgcgaggcggaaacgctctccaacgcggtgctgatt
accaccgctcacgcctggcagtatcagggagaaacgctgtttgtcagccgtaaaatctgg
cgcattgacggacagggcgaactgacgattacggtcgatgtggacgtcgccagcggcacg
ccgcatccggcgcgcgttggcctctcctgccagctcgcccaggtggcggagcgggtgaac
tggctggggctgggtccgcatgaaaactatccggatcgcctctccgccgcctgctttgac
cgctgggatctgccgcttgcggagatgtatacgccgtacgtgttcccgagcgaaaacggc
ctgcgctgcggcacccgcgaactgtgctatggcgcgcaccgctggcgcggcgacttccag
ttcaatatcagccgctatagtcagaagcagctgatggagaccagccaccgccatctgctg
cgggaagaaaacggcacatggctgaacattgatggttaccacatgggcgtgggcggcgac
gactcctggagtccgtcggtgtcgccggaataccagctcagcgcaggacgctaccactac
cagatcgtctggggccagaaataa

DBGET integrated database retrieval system