KEGG   Citrobacter rodentium: ROD_03991Help
Entry
ROD_03991         CDS       T01145                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cro  Citrobacter rodentium
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ROD_03991 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    ROD_03991 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ROD_03991 (lacZ)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ROD_03991 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(446038..449121)
Genome map
AA seq 1027 aa AA seqDB search
MNLNTDSLAAVLARRDWENPGVTQLNRLEAHPPFSSWRNADDARACRDATHKRSLNGEWR
FAWFPSPEAVPESWLTDDLQQADSVQLPSNWQMYGYDAPIYTNVTYPIPVNPPFVPSDNP
TGCYSLTFTVDDAWLREGQTRIIFDGVNSAFHLWCNGRWIGYGQDSRLPSEFDLSAFLTS
GENRLAVMVLRWCDGTYLEDQDMWRMSGIFRDVTLLHKPLTQISDLRIATHFNDDFSRAE
LAAEVRLRGELCDELRVTVQLWDGETQVGECTAPLGSEIIDERGAWHDRVSLRLKVDKPS
LWSAETPWLYRAVALLHTADGTLIEAEACDVGFREVKIENGLLLLNGKPLLIRGANRHEH
HPQNGQVMDEATMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MTPMNRLSDDPDWLPAMSQRVTRMVQRDRNHPAIIIWSLGNESGHGANHDALYRWLKAED
PSRPVQYEGGGANSAATDIICPMYARVDQDQPFPAVPKWSIKKWLSMPGEQRPLILCEYA
HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDR
QFCMDGLVFADRTPHPSLYEAKHAQQFFQFTLLPGDGMRIEVASEYLFRHSDNEILHWSI
TLDGNPVAAGEAALDIAPQGRQLIALPDIAAPDAAGQLWLTVRVEQPQATAWSPAGHISA
WQQWPLAEKLSVTIPPRAAAAPQLKVENAAFEVVVNQQRWQFCRQRGTLSQYWIADAAQL
LTPLTDQFTRAPLDNDIGISEVTRIDPNAWVERWKAAGHYRAEAQLLQCEAETLSNAVLI
TTAHAWQYQGETLFVSRKIWRIDGQGELTITVDVDVASGTPHPARVGLSCQLAQVAERVN
WLGLGPHENYPDRLSAACFDRWDLPLAEMYTPYVFPSENGLRCGTRELCYGAHRWRGDFQ
FNISRYSQKQLMETSHRHLLREENGTWLNIDGYHMGVGGDDSWSPSVSPEYQLSAGRYHY
QIVWGQK
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcaatactgattcactggccgccgtactggcccgtcgcgactgggaaaatccc
ggcgtcacgcagctcaatcgcctggaggcgcacccgccgttcagcagctggcgcaatgcc
gacgatgcccgcgcctgccgggacgctacgcacaaacgcagcctgaacggcgaatggcga
tttgcctggtttccgtcgccggaagcggtaccggagagctggctgactgacgatctgcaa
caggcggacagcgtgcagctcccctccaactggcagatgtacggttacgacgcgccgatc
tataccaacgtcacctaccccatcccggtaaacccgccttttgtgccgtcagacaatccc
accggctgttactcgctcacattcaccgttgacgacgcctggctgcgggaaggccagacg
cgaatcatttttgacggcgtgaactcggcgtttcatttatggtgcaacggacgctggatc
ggctacggccaggacagccgactgccctctgaattcgatctcagcgcttttctgacgagc
ggcgaaaaccgtctggcggtgatggtgctgcgctggtgcgacggcacgtatctggaagat
caggacatgtggcgaatgagcggcattttccgcgacgtcaccctcctgcataaaccgctt
acgcaaatcagcgatctgcggattgccacccactttaacgatgatttcagccgcgcggag
ctggccgccgaagtcagactgcgcggcgagctgtgtgacgagctgcgcgtgaccgtgcag
ctgtgggacggcgaaacgcaggtcggtgaatgcaccgccccgttgggcagcgagattatt
gacgaacgcggcgcctggcatgaccgcgtctccctgcgcctgaaggtcgataagccgtcg
ctgtggagcgctgaaacgccctggctgtaccgcgcggtggcgctgctgcacactgccgac
ggcacgctgattgaagcggaggcctgcgacgttggcttccgcgaggtcaaaattgaaaat
ggcctgctgttgctcaacggcaagccgctgctgattcgcggcgctaaccgccatgagcac
catccgcaaaacggtcaggtgatggacgaagcgacgatggtgcaggacattctgctgatg
aagcagaataactttaacgccgtgcgctgttcccattacccgaaccatccgctgtggtac
accctctgcgaccgctacggcctgtacgtggtagacgaagccaatattgaaacccacggc
atgacgccgatgaaccgcctcagcgacgatccggactggctgcccgccatgagccagcgg
gtgacgcgcatggtacagcgcgaccgtaatcatccggccattattatctggtcgctgggc
aatgagtccggtcacggcgcgaatcacgacgcgctctaccgctggctgaaggcggaagat
ccgtcacgcccggtgcagtacgaaggcggcggcgcaaacagcgcggcgacggatatcatc
tgcccgatgtatgcccgagtcgatcaggatcagccgttcccggcggtgccaaaatggtcg
atcaaaaaatggctgtcgatgccgggcgagcagcgcccgctgatcctgtgtgaatacgcc
cacgcgatgggcaacagcctcggcggattcgccaaatactggcaggcgtttcgtcagtat
ccgcgtctgcagggcggctttgtctgggactgggtcgatcagtcgctgattaagtacgat
gaaaacggcaacccgtggtcggcctacggcggcgactttggcgatacgccgaacgatcgc
cagttctgcatggacggcctggtgtttgccgaccgcacgccgcacccctcgctgtatgaa
gcgaaacacgcgcagcagtttttccagtttaccctgctgccgggcgacgggatgcgcatt
gaggtcgccagcgaatatctgttccgccacagcgacaatgagatcctgcactggtccatc
accctggacggcaacccggttgccgccggtgaagcggcgctggatatcgcaccgcaggga
cgccagcttatcgccctgcccgacattgccgctcccgacgccgcgggccagctgtggctg
acggtgcgcgtggagcagccgcaggcgaccgcgtggtcgcccgccggacacatcagcgcc
tggcagcagtggccgcttgcggaaaaactcagcgtaaccatcccgccgcgcgccgccgcc
gcgccgcagctgaaggttgaaaacgcagcctttgaggtcgttgtgaatcagcagcgctgg
cagttctgccgccagcggggcacgttgtcgcagtactggattgcggacgcagcgcagctt
ctcaccccgctcaccgaccagttcacccgcgcgccgctggataacgacatcggcatcagc
gaagtcacccgtatcgatcccaacgcctgggtcgagcgctggaaggctgccggacactac
cgcgcagaagcacagctgttgcagtgcgaggcggaaacgctctccaacgcggtgctgatt
accaccgctcacgcctggcagtatcagggagaaacgctgtttgtcagccgtaaaatctgg
cgcattgacggacagggcgaactgacgattacggtcgatgtggacgtcgccagcggcacg
ccgcatccggcgcgcgttggcctctcctgccagctcgcccaggtggcggagcgggtgaac
tggctggggctgggtccgcatgaaaactatccggatcgcctctccgccgcctgctttgac
cgctgggatctgccgcttgcggagatgtatacgccgtacgtgttcccgagcgaaaacggc
ctgcgctgcggcacccgcgaactgtgctatggcgcgcaccgctggcgcggcgacttccag
ttcaatatcagccgctatagtcagaagcagctgatggagaccagccaccgccatctgctg
cgggaagaaaacggcacatggctgaacattgatggttaccacatgggcgtgggcggcgac
gactcctggagtccgtcggtgtcgccggaataccagctcagcgcaggacgctaccactac
cagatcgtctggggccagaaataa

DBGET integrated database retrieval system