KEGG   Citrobacter rodentium: ROD_05301Help
Entry
ROD_05301         CDS       T01145                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
cro  Citrobacter rodentium
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cro00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ROD_05301 (recR)
DNA repair and recombination proteins [BR:cro03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ROD_05301 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
589693..590298
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLSAEPLNEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKLKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaactcagcttatggaagcgcttcgctgtctgccgggcgtc
ggtccgaagtcggcgcagcgcatggcgtttacgctgcttcagcgtgaccgcagcggcggg
atgcgtctggcgcaggcgctgacccgggcgatgtcggaaatcggccactgcgccgattgc
cggaccttcaccgagcaggaggtgtgcaatatctgttcgaacccgcgacgtcaggaaaac
ggccagatttgcgtcgtcgaaagcccggcggatatttacgcgattgagcagaccgggcag
ttttccgggcgctactttgtgctgatggggcatctgtcgccgctcgacggcatcgggccg
gatgatatcgggcttgaccgacttgagcagcgtctctctgccgagccgctcaacgaggtg
atcctcgcgactaacccgacggtcgaaggcgaagccaccgccaactatattgccgagctt
tgcgcgcaatatggcgtcgatgccagccgtatcgcccacggcgtgccggttggcggcgaa
ctggaaatggtcgacggcaccacgctgtcgcactctcttgccggtcgccataagcttaaa
ttctga

DBGET integrated database retrieval system