KEGG   Citrobacter rodentium: ROD_07681Help
Entry
ROD_07681         CDS       T01145                                 

Definition
acyl-CoA thioester hydrolase (EC:3.1.2.-)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cro  Citrobacter rodentium
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cro00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cro00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(845581..846864)
Genome map
AA seq 427 aa AA seqDB search
MNTSSVSRLALALAFGVTLTACSSTPPDQIPSDQTAPGTASRPILSASEAQNFVAKHYFS
SLTPNTAPWTPSAINLPAQPDFVVGPAGTSGVTHTTIQAAVDAAITTRTNRRLYIAIMPG
EYPGTVYIPAAPGSLTLYGTGDKPLDVKIGAAIDGQMGTSDWRRVVNPGGKYMPGKPAWY
MFDSCQSKRSASIGMMCSAVLWSQNNGLQLQNLTVENNLGDSVDAGNHPAVALRSDGDKV
QINNVNILGRQNTFFVTNSGVQNRLVNDRQTRTLVTNSYIEGDVDIVSGRGAVVFDNTDF
RVVNSRTQQEAYVFAPATLSNIYYGFLATNSRFTAAGDGVAQLGRSLDVDSNTNGQVVIR
DSVINEGFNLAKPWADAVISGRPFAGNTGTQDEKGEIQRNLNDASFNRMWEYNNRGVGSK
VLAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacatcatcagtttcccgtctggcgctggcactggcttttggcgtgacgctgacc
gcctgtagctcaaccccgccggatcaaattccgtccgatcagaccgcgccgggtactgcc
tcgcgcccgattttgtcggccagcgaagcgcagaattttgtcgcgaagcactatttttcc
tcgctgacgccgaataccgcgccgtggacgccatcggcgattaatctgcctgcgcagcct
gattttgtcgtcggcccggccgggacgtcgggggtgacccataccactattcaggctgcg
gtagacgcggcaatcaccacccgcaccaacagacgtctgtatattgcgattatgccgggc
gaatatccgggtaccgtgtatatccccgctgcgccgggcagtctgacgctgtacggcacc
ggcgataagccgctggatgtgaaaattggcgcggcgattgatggtcagatggggacttct
gactggcgtcgggtggtgaatcccggcgggaaatatatgcctggcaaaccggcctggtat
atgttcgacagctgccagagtaaacgcagcgccagcatcggcatgatgtgttccgcggtg
ctgtggtcgcagaataacggcctgcaattgcagaacctgaccgttgaaaacaatctgggc
gacagcgtggacgccggcaaccatccggcggtagcgctgcgcagcgatggcgacaaagtg
cagatcaacaacgtcaatatcctcggtcgccagaacaccttctttgtcaccaacagcggc
gtgcagaaccgtctggtgaacgatcgccagacgcgcactctggtgaccaacagctatatc
gaaggcgatgtcgatatcgtttccggtcgcggcgcagtggtgtttgataacaccgatttc
cgcgtggtcaactcccgtactcagcaggaagcgtatgtgttcgccccggcaacgctgtcg
aacatctattacggtttcctcgccaccaacagccgctttaccgccgctggcgatggcgtc
gcgcagctgggccgctcgctggatgtcgacagcaataccaacggccaggtggttatccgc
gacagcgtgatcaacgaaggctttaacctggcgaagccgtgggcggacgcagtgatttct
ggccgtccgttcgccggtaacaccggtacgcaggatgagaaaggcgagattcagcgtaat
ctgaacgacgccagctttaaccgcatgtgggaatacaataaccgcggcgtgggcagcaaa
gtactggcggagccaaagcagtaa

DBGET integrated database retrieval system