KEGG   Citrobacter rodentium: ROD_08021Help
Entry
ROD_08021         CDS       T01145                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cro  Citrobacter rodentium
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ROD_08021 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROD_08021 (adh)
   00620 Pyruvate metabolism
    ROD_08021 (adh)
   00650 Butanoate metabolism
    ROD_08021 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    ROD_08021 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ROD_08021 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ROD_08021 (adh)
   00626 Naphthalene degradation
    ROD_08021 (adh)
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ROD_08021 (adh)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ROD_08021 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
881333..883945
Genome map
AA seq 870 aa AA seqDB search
MSINSIEELNALVARVKKAQREYASFSQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVIVVDAIYDAVKARFAKSGAVILNKKEKRATGDILLKNGALNAAIVGQP
AYKIAELAGFSVPENTKILIGEVTVVDDSEPFAHEKLSPTLAMYRAKDFEDAVSKAEKLV
AMGGIGHTSCLYTDQDNQPERVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPVALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYNEGAKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESLKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLVSELRQLLLASYYGKEFSEG
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattaattccattgaagaattaaacgcgctggtggcgcgcgtcaaaaaagcccag
cgtgaatatgccagtttcagtcaggagcaggtcgataaaatcttccgcgccgccgctctg
gccgcggcagatgcccgcatccctctcgctaagatggccgttgccgaatccggtatgggt
atcgttgaagataaagtgatcaaaaaccactttgcttccgaatacatctataacgcttat
aaagatgaaaagacctgcggcgtgctgtccgaggacgacaccttcgggaccatcaccatt
gctgaaccaatcggtatcatctgcggtatcgttccgaccactaacccgacctccacggct
atcttcaaatcgctgatcagcctgaagacccgtaacgccatcatcttctctccgcacccg
cgtgctaaagaggccaccaacaaagcggctgacatcgtactgcaggcggctatcgctgcc
ggcgcgccgaaagatctgatcggctggatcgatcaaccttccgttgagctctccaacgcc
ctgatgcatcacccggatatcaacctgatcctcgcgacaggcggcccgggcatggtgaaa
gcggcctacagctccggtaaaccggcgatcggcgtgggcgcaggcaacaccccggtggtc
atcgacgaaactgccgatatcaaacgtgccgtcgcgtccgtgctgatgtccaaaaccttc
gataacggcgttatttgcgcatctgaacagtcggtgattgttgtagatgccatttatgat
gcggtaaaagcgcgtttcgccaaaagcggcgctgttattctcaataagaaagagaaaagg
gcgacaggcgacattcttctgaaaaatggcgcgctgaacgccgctatcgtgggtcagccg
gcgtataagatcgctgaactggcgggcttctccgtgccggaaaacaccaagatcctgatt
ggcgaagtcaccgttgttgatgacagcgagccgtttgctcacgaaaaactctccccgacg
ctggcgatgtaccgcgcgaaagatttcgaggacgcggtcagcaaagccgagaagctggtg
gcgatgggcggtatcggccacacctcctgcctgtacaccgaccaggacaaccagccggag
cgcgtcgcttacttcggccagatgatgaaaaccgcgcgtatcctgatcaacaccccggct
tcccagggcggtatcggtgacctctacaacttcaagctggccccttccctgacgctgggt
tgcggctcctggggcggtaactccatctctgaaaacgtcggtccgaagcacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatccatc
tacttccgccgcggctccctgcctgtcgcgctggacgaagtgattaccgacggccacaaa
cgtgcgctcattgtgaccgaccgtttcctgttcaacaacggttacgctgaccagatcacc
tccgtgctgaaagcggccggcgttgaaaccgaagtgttctttgaagtggaagccgacccg
accctttccgtggtgcgtaagggcgctgagctggcgaactccttcaaaccggacgtgatc
atcgcgctgggcggcggttccccgatggacgccgcgaaaatcatgtgggtgatgtacgaa
catccggaaacccacttcgaggagctggcgctgcgctttatggatatccgtaagcgtatc
tacaagttcccgaaaatgggcgtgaaagcgaagatgatcgccgtcaccaccacttccggc
accggttccgaagtcacgccgtttgcggtggtcaccgacgatgcaaccgggcagaaatac
ccgctggcagattatgcgctgacgccggatatggcgattgttgacgccaacctcgtgatg
gacatgccgaagtcgctgtgtgcgttcggtggtctggatgcggtcacccacgcgctggaa
gcctacgtttccgtactggcctccgagttctctgacggccaggcgctgcaggcgctgaaa
ctgctgaaagaaaacctgccggcgtcctacaacgaaggggcgaaaaacccggtagcccgt
gagcgcgtgcacagcgcggccaccatcgccggtatcgcgtttgccaacgccttcctcggc
gtctgccactcgatggcgcacaagctgggctcgcagttccacattccgcacggcctggcg
aacgccctgctgatcagtaacgtgatccgctataacgccaacgacaacccgaccaagcag
acggcattcagccagtacgaccgtccgcaggcgcgccgtcgctacgcggaaattgccgac
catctgggtctgagcgcgccgggcgaccgcaccgcggcgaagattgagaagctgctggcg
tggctggaaagcctgaaagccgagctgggtattccgaagtccatccgtgaagctggcgtg
caggaagcggacttcctggcccacgttgacaagctgtctgaagatgctttcgatgaccag
tgcaccggcgccaacccgcgctacccgctggtatcggaactgcgtcagctactgctggcc
agttattatggcaaggaattcagcgaaggctaa

DBGET integrated database retrieval system