KEGG   Citrobacter rodentium: ROD_10411Help
Entry
ROD_10411         CDS       T01145                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cro  Citrobacter rodentium
Brite
Enzymes [BR:cro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ROD_10411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1149904..1150443
Genome map
AA seq 179 aa AA seqDB search
MATSKTKLSAAVLALVLSGASAPVILDQFLNEKEGNSFPAHKDGGGIWTICRGATMVDDK
LVVQGMKLTQAKCDRVNAIERDKALAWVNLNIKVPLTEPQKAGIASFCPYNIGPGKCFPS
TFFKRINAGDRKGACEAIRWWIKDGGRDCRLTKGQKNGCYGQVECRDQESALACWGIDQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggctaccagcaaaactaagctcagtgctgctgttctggccctagtcttatcaggcgcc
tccgccccggtgatactcgatcagttcctgaacgagaaagagggtaacagcttccctgcg
cacaaagacggcggtgggatctggacgatttgtcgcggcgctacgatggttgatgataag
ctggtggtgcaaggcatgaagctgacgcaagctaaatgtgaccgggtaaacgccatcgaa
cgggataaggcactggcgtgggttaacctgaatatcaaggtgccgctgaccgaaccgcag
aaagcaggtattgcttcattctgcccgtacaacatcggccccggtaaatgtttcccctca
acgttcttcaagcgcatcaatgccggtgaccgcaaaggggcttgtgaagcgatccgctgg
tggattaaagacggtggccgcgactgtcggctgacaaaaggccagaagaatggctgctat
ggtcaggttgagtgtcgggatcaggaaagcgcgcttgcgtgctgggggatagaccagtga

DBGET integrated database retrieval system