KEGG   Citrobacter rodentium: ROD_17001Help
Entry
ROD_17001         CDS       T01145                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
cro  Citrobacter rodentium
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ROD_17001
Enzymes [BR:cro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ROD_17001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1811386..1813095)
Genome map
AA seq 569 aa AA seqDB search
MGPLPRKSKVKQKIQDCLRHVYGDTWTARHQEMLEERVKRTRNTISGTRKPHWDESDVVL
ITYADQFHSEKEKPLPTFNRFWSQWLRSVFSHVHLLPFYPWSSDDGFSVIDYYQVASETG
DWNDIKTLNQSCHLMFDFVCNHMSAQSEWFNHYLQQTPGYENFFIEMDPQTDLSAVTRPR
ALPLLTPFTLQDNSVRHLWTTFSADQIDLNYANPDVLLAMVDVLLTYLERGADYVRLDAV
GFMWKTPGTRCIHLEKTHQLIKLFRAIADDVAPGTAIITETNVPHQDNISYLGNGYDEAH
MVYQFSLPPLVLHAVHRQDTRVLCQWAQSLKLPSPKTTWFNFLASHDGIGLNPLRGLLAE
EDILSLVAGLQKEGALVNWKNNPDGSRSPYEINVTYMDALSSGDSSDDERLAKFMLAHAL
LLTFPGIPAIYIQSILGSRNDNEGVAELGYNRAINRKKYSLQSIESELMNDGSLRHRVYQ
TLSRLVMIRRKTKAFHPESGFTINSITPAVLRIIRRADEDELITAFFNFSDRRQTVNTVT
LCGTDLISEDNVSGETLTLQPWQVMWIKK
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctaccacggaaaagtaaagtgaagcaaaaaattcaggactgcctccgccat
gtttatggcgatacatggaccgcgcggcatcaggaaatgttagaagaacgcgttaaaaga
acgcgtaatactattagtggaacacgtaagccacactgggatgaaagcgatgtggtgctt
attacttatgccgatcaatttcacagtgagaaagaaaaaccgctgccaacctttaatcgc
ttctggtctcagtggctacggtcggtattttctcacgttcatcttttacctttttatccg
tggtcgtccgacgatggattttccgtaatagattactatcaggtcgccagtgaaacgggc
gactggaatgatattaaaaccctgaatcaatcctgccatttaatgtttgattttgtctgc
aatcatatgtcggcgcagagtgaatggtttaatcactatttacagcagacgcccggctat
gaaaatttctttattgaaatggacccgcagaccgatttaagcgcggtaacgcgtccgcgc
gcgttacctttgctgacgccgtttacgctgcaggataattcagtgcgccatttatggaca
accttcagcgcagatcaaatagacctgaattacgccaaccccgacgtgctgctggcgatg
gtcgacgtactgttgacctaccttgaacggggcgctgactatgtgcgtctcgacgcggtc
ggctttatgtggaaaacgccggggacccgctgtatccatctggaaaagacccatcagctg
atcaagctgttccgcgccattgctgacgacgtggcgccgggtacggcaatcatcaccgaa
accaacgttccgcatcaggacaacatctcctatctgggaaatggctacgacgaagcccac
atggtgtatcagttctccctgccgccgctggtgctgcatgcggtgcatcgtcaggatacg
cgcgtgctgtgccagtgggcgcagtcgcttaagctgccttcgccgaagaccacctggttt
aactttcttgcttctcacgacggcattggtcttaatccgctacgcggtctgttagcggaa
gaggatattttatcgctggttgccgggctgcaaaaagagggcgcgctggttaactggaaa
aataacccggacggcagtcgtagcccctatgaaattaatgtcacttatatggatgcgctc
agttcgggtgacagcagcgacgacgagcggctggcgaaatttatgctcgcgcatgcctta
ctgctgacctttccgggtattccggcgatttatatccagagtattctggggtcacgaaat
gacaatgaaggggtggcggaactgggctataaccgtgcgattaatcgcaaaaaatattcg
ctgcaatcgattgagtctgagctaatgaatgacggatctcttcgccatcgcgtataccag
acattatcccggctggtaatgattcgccgaaagactaaagcgtttcacccggaaagtggc
tttacgataaacagtattacgcctgcggtgttgagaattattcgcagggcagacgaagac
gagctaattaccgctttctttaatttcagcgatcgccgtcagacagttaatacagtaacg
ctttgcggaacggatttgattagtgaagataatgtttccggtgaaacattaacgctgcaa
ccctggcaggttatgtggattaaaaaataa

DBGET integrated database retrieval system