KEGG   Citrobacter rodentium: ROD_17421Help
Entry
ROD_17421         CDS       T01145                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cro  Citrobacter rodentium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ROD_17421 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ROD_17421 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ROD_17421 (trpB)
Enzymes [BR:cro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ROD_17421 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1852554..1853747
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPQFQAQFSDLLKNYAGRPTALT
KCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YENAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIDETSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEEGQIEESYSI
SAGLDFPSVGPQHAWLNSTGRADYVSITDDEALEAFKTLCRNEGIIPALESAHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattactcaatccctattttggtgaatttggcggcatgtacgtgccgcagatc
ctgatgcccgcgctgcgccagctggaagaagcgtttgtcagcgcgcagaaagatccgcag
tttcaggcgcagttcagcgacctgctgaaaaactacgccggtcgccctaccgccctgact
aaatgtcagaacatcaccgccggcacccgcaccacgctgtatctgaagcgtgaagatttg
ctgcacggcggcgcgcataaaaccaaccaggtgttaggtcaggcgctgctggcgaaacga
atgggcaaaaccgagattatcgctgaaaccggcgccggccagcacggggtcgcctcggcg
ctggccagcgccctgctcggcctgaaatgccgtatctatatgggggcgaaggacgtcgaa
cgccaatcgccgaacgtgtttcgtatgcggctgatgggcgccgaggtcattccggtgcac
agcggctcggcgacgctgaaagatgcctgtaacgaggcgctgcgcgactggtcgggcagc
tatgaaaacgcgcactacatgcttggcaccgccgcggggccgcaccccttcccgacgatt
gtgcgcgaattccagcggatgattggcgaagagaccaaagcgcaaatccttgaaaaagaa
ggtcgcctgccggatgcggtgatcgcctgcgtcggcggcggctccaacgctatcggcatg
tttgccgacttcatcgacgaaaccagcgtcggattgatcggcgttgagcccggcggtcac
gggattgaaaccggcgaacacggcgcgccgttgaagcatggccgcgtcggaatttacttc
ggcatgaaagcgccgatgatgcagaccgaagaggggcagattgaagaatcttattcgatc
tccgcagggctcgatttcccgtctgtcggcccgcagcacgcctggctgaacagcactggc
cgcgccgattacgtgtcgattaccgacgatgaagcgctggaggcgttcaagacgctttgc
cgcaatgaagggatcattccggcgctggaatcagcgcatgcgctggcccacgcgctgaaa
atgatgcgtgagaacccggaaaaagagcagctattggtggtcaatctttccggtcgcggc
gataaagacatctttacggtacacgatattctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system