KEGG   Citrobacter rodentium: ROD_17431Help
Entry
ROD_17431         CDS       T01145                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cro  Citrobacter rodentium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ROD_17431 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ROD_17431 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ROD_17431 (trpA)
Enzymes [BR:cro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ROD_17431 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1853747..1854553
Genome map
AA seq 268 aa AA seqDB search
MERYETLFAQLNDRKEGAFVPFVTLGDPGVEQSLKIIDALIEAGADALELGIPFSDPLAD
GPTIQSATLRAFAAGVTPTRCFEMLAAIRAKHPTIPIGLLMYANLVFSKGIDDFYAQCAK
VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQIASYGRAYTYLLSRA
GVTGAENRAALPLHHLVEKLTEYHAAPSLQGFGISAPEQVSAAIEAGAAGAISGSAIVKI
IERNVDNPQQMLDELKAFVSSMKAATRR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaaacgctgtttgcacaactcaacgatcgcaaggaaggcgcctttgtc
cctttcgtcacgctcggcgatcctggcgttgagcagtcgctgaaaattatcgatgccctg
attgaagcgggcgccgacgcgctggagctggggatccccttctccgatccgcttgctgac
ggcccgaccatccagagcgccaccctgcgcgcctttgccgctggcgtgacgcccacgcgc
tgctttgaaatgctggcggccattcgcgcgaaacacccgaccattcccattggcctgctg
atgtacgccaatctggtgttcagtaagggtatcgatgacttttacgcccagtgcgcaaaa
gtcggcgtcgattcggtcctcgtcgccgacgtgccggttgaggagtctgcgcccttccgt
caggccgcgctgcgccacaatatcgcccctatcttcatctgtccgccgaatgcggatgac
gacctgctgcgccagattgcctcttatggccgcgcttatacctatctgctgtcgcgtgca
ggggttaccggtgcggagaaccgcgcggcgctgccgctgcatcatctggtcgaaaagctg
acggagtaccatgcggcgccctcgctgcagggctttggcatctctgcgccggaacaggta
tctgccgcaattgaagccggtgcggcgggcgctatctccggctcggcaatcgtgaagatc
atcgaacgcaatgtcgataatccgcagcagatgctggacgaattaaaagccttcgtcagc
agtatgaaagccgccacccgtcgttag

DBGET integrated database retrieval system