KEGG   Citrobacter rodentium: ROD_17721Help
Entry
ROD_17721         CDS       T01145                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cro  Citrobacter rodentium
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ROD_17721 (galU)
   00052 Galactose metabolism
    ROD_17721 (galU)
   00500 Starch and sucrose metabolism
    ROD_17721 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ROD_17721 (galU)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ROD_17721 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1880161..1881069)
Genome map
AA seq 302 aa AA seqDB search
MAAINSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGNEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVDDVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLGADIWALLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEEEVGI
KR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattaactcgaaagtcaaaaaagccgttatcccggtagcgggattaggaacc
aggatgttgccggcaacaaaagctatcccgaaagagatgttgccactggttgataagcca
ttaattcagtatgtggttaacgaatgtattgctgcgggcatcactgaaattgtgctggtg
acgcactcctcgaagaattctatcgaaaaccattttgataccagctttgaactggaagcg
atgcttgaaaaacgcgttaagcgccagctgctcgaagaagtacagtctatttgtccgccg
cacgtcactattatgcaggtgcgccaggggctggcgaaaggtctgggccacgcagtattg
tgcgcgcatcctgtggtaggcaatgaacctgtcgcggttattttgccggacgttattctc
gatgagtatgaatcagatttatcccaggataaccttgcggaaatgattcgtcgttttgat
gaaaccggacacagccagattatggttgaaccggtagacgatgttaccgcttacggcgta
gttgactgtaaaggcgttgaattagcgccgggcgaaagcgtgccgatggttggcgtggtc
gagaagccgaaagcggacgtcgcgccgtctaatctggccattgtcggacgttacgtcctc
ggcgctgatatctgggcgctgctggcgaaaacccctccaggagctggcgatgagattcag
cttaccgacgcgatcgacatgctgatcgaaaaggaaaccgtcgaagcctatcatatgaaa
ggcaaaagccatgactgcggtaataaattaggctacatgcaggcatttgtagaatatggc
attcgacataataccctcggcacagaatttaaggcctggctcgaagaagaagtgggtatt
aaacggtaa

DBGET integrated database retrieval system