KEGG   Citrobacter rodentium: ROD_18551Help
Entry
ROD_18551         CDS       T01145                                 

Gene name
manX
Definition
mannose-specific PTS system EIIAB component (EC:2.7.1.69)
Orthology
K02793  
PTS system, mannose-specific IIA component [EC:2.7.1.69]
K02794  
PTS system, mannose-specific IIB component [EC:2.7.1.69]
Organism
cro  Citrobacter rodentium
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ROD_18551 (manX)
   00520 Amino sugar and nucleotide sugar metabolism
    ROD_18551 (manX)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    ROD_18551 (manX)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     ROD_18551 (manX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1976608..1977576
Genome map
AA seq 322 aa AA seqDB search
MTIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTSK
GVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETFMARDDNPEFDELVQLAVE
TGREGVKALKAKPVETAAPAPVAAAPKAAAPAKPMGPNDYMVIGLARIDDRLIHGQVATR
WTKETNVTRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVYNNPKYAGERVM
LLFTNPTDVERIVEGGVKITSVNIGGMAFRQGKTQVNNAISVDAKDIEAFNKLNARGIEL
EARKVSTDPKLKMMDLIAKVGK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattgctattgtgataggcacacatggttgggctgcagagcagttacttaaaacg
gcagagatgttgttaggcgagcaggagaacgtcggctggatcgatttcgtacccggcgaa
aacgccgaaacgctgatcgaaaagtacaacgctcagttagcaaaactcgataccagtaaa
ggcgtgctgttcctcgtcgatacctggggcggcagcccgtttaacgctgccagccgtatt
gttgtcgacaaagagcattatgaagttatcgctggcgtcaatatcccgatgctggtggaa
accttcatggcgcgcgacgacaacccggagtttgacgaactggtgcagcttgccgtcgaa
accggtcgcgaaggcgtgaaagcgctgaaggccaaaccggtcgaaaccgcggcgccagcc
cctgttgccgccgcgcccaaagccgccgccccggcaaaaccgatgggtccgaacgattac
atggtgatcggcctcgcgcgcatcgatgaccgtttaatccacggccaggtggcgacccgc
tggaccaaagaaactaacgtcacccgcattatcgtcgtcagcgatgaagttgccgccgat
accgtgcgtaaaacgctgttaactcaggtcgcgccgcccggcgtcacggctcacgtggtt
gacgtcgccaagatgatccgcgtgtacaacaacccgaaatacgccggcgagcgggtaatg
ctgctgttcactaacccgaccgacgtcgagcgtattgtcgaaggcggcgtaaagatcacc
tccgtaaacattggcgggatggctttccgtcagggcaaaactcaggtgaacaacgccatc
tccgtcgatgcgaaagatattgaagccttcaataaactcaacgcgcgcggtattgagctt
gaagcgcggaaggtttcaaccgatccgaaactgaaaatgatggatttgatcgccaaagtg
ggcaagtaa

DBGET integrated database retrieval system