KEGG   Citrobacter rodentium: ROD_18551Help
Entry
ROD_18551         CDS       T01145                                 

Gene name
manX
Definition
mannose-specific PTS system EIIAB component (EC:2.7.1.69)
Orthology
K02793  
PTS system, mannose-specific IIA component [EC:2.7.1.69]
K02794  
PTS system, mannose-specific IIB component [EC:2.7.1.69]
Organism
cro  Citrobacter rodentium
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, mannose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cro00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cro00520]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:cro02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1976608..1977576
Genome map
AA seq 322 aa AA seqDB search
MTIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTSK
GVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETFMARDDNPEFDELVQLAVE
TGREGVKALKAKPVETAAPAPVAAAPKAAAPAKPMGPNDYMVIGLARIDDRLIHGQVATR
WTKETNVTRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVYNNPKYAGERVM
LLFTNPTDVERIVEGGVKITSVNIGGMAFRQGKTQVNNAISVDAKDIEAFNKLNARGIEL
EARKVSTDPKLKMMDLIAKVGK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattgctattgtgataggcacacatggttgggctgcagagcagttacttaaaacg
gcagagatgttgttaggcgagcaggagaacgtcggctggatcgatttcgtacccggcgaa
aacgccgaaacgctgatcgaaaagtacaacgctcagttagcaaaactcgataccagtaaa
ggcgtgctgttcctcgtcgatacctggggcggcagcccgtttaacgctgccagccgtatt
gttgtcgacaaagagcattatgaagttatcgctggcgtcaatatcccgatgctggtggaa
accttcatggcgcgcgacgacaacccggagtttgacgaactggtgcagcttgccgtcgaa
accggtcgcgaaggcgtgaaagcgctgaaggccaaaccggtcgaaaccgcggcgccagcc
cctgttgccgccgcgcccaaagccgccgccccggcaaaaccgatgggtccgaacgattac
atggtgatcggcctcgcgcgcatcgatgaccgtttaatccacggccaggtggcgacccgc
tggaccaaagaaactaacgtcacccgcattatcgtcgtcagcgatgaagttgccgccgat
accgtgcgtaaaacgctgttaactcaggtcgcgccgcccggcgtcacggctcacgtggtt
gacgtcgccaagatgatccgcgtgtacaacaacccgaaatacgccggcgagcgggtaatg
ctgctgttcactaacccgaccgacgtcgagcgtattgtcgaaggcggcgtaaagatcacc
tccgtaaacattggcgggatggctttccgtcagggcaaaactcaggtgaacaacgccatc
tccgtcgatgcgaaagatattgaagccttcaataaactcaacgcgcgcggtattgagctt
gaagcgcggaaggtttcaaccgatccgaaactgaaaatgatggatttgatcgccaaagtg
ggcaagtaa

DBGET integrated database retrieval system