KEGG   Citrobacter rodentium: ROD_21741Help
Entry
ROD_21741         CDS       T01145                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cro  Citrobacter rodentium
Pathway
cro00521  Streptomycin biosynthesis
cro00523  Polyketide sugar unit biosynthesis
cro01130  Biosynthesis of antibiotics
Module
cro_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ROD_21741 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ROD_21741 (rfbC)
Enzymes [BR:cro01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ROD_21741 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CBG88923
UniProt: D2TQJ1
Position
complement(2270248..2270796)
Genome map
AA seq 182 aa AA seqDB search
MKVIKTEIPDVLIFEPKVFGDERGFFMESFNQKVFEEAIGRKVDFVQDNHSKSSKGVLRG
LHYQLAPYAQAKLVRCIAGEVFDVAVDIRESSPTFGKWVGVNLSAENKRQLWIPEGFAHG
FLVLSETAEFVYKTTNYYHPECDRGIRWDDAYIGIKWGNDYNVKLSDKDKKNPTMKDVFM
FM
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttattaaaacagaaatccctgatgtattaatttttgaaccgaaagtgtttggt
gatgaacgtgggttcttcatggaaagctttaatcagaaagtttttgaagaagccataggc
cgaaaggttgattttgtgcaggataaccattcaaaatcttctaaaggtgtgcttagaggt
ttacactaccaattagcaccttatgcgcaagccaaacttgttcgctgtattgcaggtgaa
gtttttgatgtggccgtagatattcgtgaatcttcgcctacctttgggaaatgggttggg
gttaatttgtctgctgagaataagcgtcagttgtggatccctgaggggtttgcacatgga
tttttggtgctgagtgaaacggcggaatttgtttataagacgacgaattattatcatcct
gaatgtgacagaggtattaggtgggatgatgcctatataggaattaaatgggggaatgac
tacaacgtaaaattgtcagataaagacaaaaaaaatccaacaatgaaagacgtttttatg
tttatgtaa

DBGET integrated database retrieval system