KEGG   Citrobacter rodentium: ROD_21781Help
Entry
ROD_21781         CDS       T01145                                 

Gene name
galF
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cro  Citrobacter rodentium
Pathway
cro00040  Pentose and glucuronate interconversions
cro00052  Galactose metabolism
cro00500  Starch and sucrose metabolism
cro00520  Amino sugar and nucleotide sugar metabolism
cro01100  Metabolic pathways
cro01130  Biosynthesis of antibiotics
Module
cro_M00362  Nucleotide sugar biosynthesis, prokaryotes
cro_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ROD_21781 (galF)
   00052 Galactose metabolism
    ROD_21781 (galF)
   00500 Starch and sucrose metabolism
    ROD_21781 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    ROD_21781 (galF)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ROD_21781 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: CBG88927
UniProt: D2TQJ5
Position
complement(2274089..2274982)
Genome map
AA seq 297 aa AA seqDB search
MINLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
IGNNPFVVVLPDIIIDNASADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
DPLDTEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKILSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttgaaagcagttataccggtagcgggtctgggtatgcacatgttgcctgcc
accaaggcaattcccaaagagatgctgccgatcgtcgacaagccgatgattcagtacatc
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcatgcgtccaag
aacgccgttgagaaccacttcgacacctcatatgaattagagtcgcttctggagcagcgc
gttaagcgtcagctgctggcggaagtacagtccatttgtccgccgggcgtgaccatcatg
aacgttcgtcaggcgcagccgctggggctgggacactcaatcctttgtgcccgcccggtt
atcggtaacaacccgtttgtggtggttctgccagatatcattatcgataacgccagtgca
gatccgctgcgctataacctcgctgcgatggtggcccgtttcaacgaaaccggtcgtagc
caggtgctggcgaaacgtatgaagggcgatctttcagagtactcagtgatccagacaaaa
gatccgctggatacggaaggcaaagtcagccgcatcgtcgagttcatcgagaagccggac
cagccacagacgctggattccgatctgatggcagtaggacgctatgtgctttccgcagat
atctgggccgagctggaaagaacggaaccgggcgcctggggacgtatccagttaacggat
gcaatagctgaactggcgaaaaaacagtctgtggatgcgatgctaatgactggcgatagc
tatgactgcggtaagaaaatgggctatatgcaggcgtttgtgaagtacggactgcggaac
ctgaaggaaggggcgaagttccggaaggggattgagaaaattcttagcgagtaa

DBGET integrated database retrieval system