KEGG   Citrobacter rodentium: ROD_22811Help
Entry
ROD_22811         CDS       T01145                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cro  Citrobacter rodentium
Pathway
cro00790  Folate biosynthesis
cro01100  Metabolic pathways
Module
cro_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ROD_22811 (folE)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ROD_22811 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF4844
Motif
Other DBs
NCBI-ProteinID: CBG89029
UniProt: D2TRI2
Position
complement(2393426..2394094)
Genome map
AA seq 222 aa AA seqDB search
MSSLSKEAALVHEALVARGLETPLRPPVHEMDNETRKRLISGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDAVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactcagtaaagaagcggctctggtacacgaagcgctggttgcgcgagggctg
gaaacgccgctgcgtccccccgtgcatgagatggataacgaaacgcgcaaacgtcttatc
tcaggccatatgaccgagatcatgcaactgcttaatctcgacctgagcgatgacagcctg
atggagacgccgcatcgcatcgccaaaatgtatgtcgatgagattttctccggccttgat
tacgcgaatttcccgaaaatcaccgtcattgaaaacaaaatgaaggtcgatgagatggtg
accgtgcgcgacatcaccctcaccagcacctgcgaacaccattttgtcaccatcgacggc
aaggcgacggtggcctatatcccgaaagatgcggtgattggcctgtcaaaaatcaatcgt
atcgtgcagttcttcgcccagcgtccgcaggtgcaggagcgcttaacgcagcagatcctt
accgcgctgcaaacgctgctcggcaccaataacgtggcggtatccattgacgcggtgcac
tactgcgtgaaagcgcgcggcatccgcgatgcgaccagcgccaccaccaccacctcgctc
ggcgggctgtttaaatcgagccagaacacgcgtcaggaatttttgcgcgccgtacgtcat
cacaactga

DBGET integrated database retrieval system