KEGG   Citrobacter rodentium: ROD_24421Help
Entry
ROD_24421         CDS       T01145                                 

Gene name
purM
Definition
phosphoribosylaminoimidazole synthetase (EC:6.3.3.1)
Orthology
K01933  
phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
cro  Citrobacter rodentium
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cro00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2565760..2566797
Genome map
AA seq 345 aa AA seqDB search
MTDKTSLSYKDAGVDIDAGNALVDRIKGVVKKTRRPEVMGGLGGFGALCALPQKYREPVL
VSGTDGVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAA
SVINGIAEGCLQSGCALVGGETAEMPGMYHGEDYDVAGFCVGVVEKSEIIDGSKVADGDV
LIALGSSGPHSNGYSLVRKIVEVSGCDPQTTDLDGKPLADHLLAPTRIYVKSILELIEKA
DVHAIAHLTGGGFWENIPRVLPDSTQAVINESSWQWPAVFNWLQNAGNVSQHEMYRTFNC
GVGMIIALPASEVDNALALLRAKGENAWKIGHIRASDAEQRVVIE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgataaaacctctcttagctacaaagatgccggtgttgatattgatgcgggcaat
gccctggtggatcgaatcaaaggcgtagtgaagaaaactcgtcgcccggaggtcatgggc
gggctgggtggcttcggtgcgctgtgcgcgttgccgcaaaaatatcgtgaaccggtactg
gtttccggcactgacggcgtgggcaccaagctgcgtctggcgatggatctgaaacgtcat
gacaccattggtatcgatctggtggcgatgtgcgtcaacgatctggtggtacagggcgcg
gagccgctgtttttcctcgactactacgcgacgggcaaactggacgtcgacaccgctgcc
agcgtaattaacggtatcgctgaaggctgtctgcaatccggctgcgcgctggtaggcggt
gaaaccgcagaaatgccggggatgtatcacggtgaagattacgatgtcgctggtttctgc
gtcggagtagtggaaaagtcagaaattatcgacggctctaaagttgccgatggcgatgtg
ctgattgcgctgggctccagcggcccgcactccaacggctattcgctggtgcgcaaaatt
gtggaagtcagcggttgcgatccgcaaacaaccgatctcgacggcaagccgttagccgat
cacctgctggcgccgacccgcatctatgtgaaatcgattctcgaactgatcgagaaggcc
gacgtacacgccattgcgcacctgaccggcggcggcttctgggaaaatattccgcgcgtt
ctgccggacagcacccaggcggtcatcaacgaatcgtcatggcagtggccagccgtcttt
aactggctgcaaaacgccggcaacgtcagccagcacgaaatgtatcgtacctttaactgc
ggagtcgggatgattatcgccctgccggcaagcgaagtggataatgcgctggctctgctg
cgggcaaaaggtgaaaatgcgtggaaaatcggtcatatcagggcatctgatgccgaacag
cgcgtggttatcgaataa

DBGET integrated database retrieval system