KEGG   Citrobacter rodentium: ROD_28061Help
Entry
ROD_28061         CDS       T01145                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cro  Citrobacter rodentium
Pathway
cro00010  Glycolysis / Gluconeogenesis
cro00052  Galactose metabolism
cro00500  Starch and sucrose metabolism
cro00520  Amino sugar and nucleotide sugar metabolism
cro00521  Streptomycin biosynthesis
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01120  Microbial metabolism in diverse environments
cro01130  Biosynthesis of antibiotics
cro01200  Carbon metabolism
Module
cro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cro_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROD_28061 (glk)
   00052 Galactose metabolism
    ROD_28061 (glk)
   00500 Starch and sucrose metabolism
    ROD_28061 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ROD_28061 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ROD_28061 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ROD_28061 (glk)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ROD_28061 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: CBG89549
UniProt: D2TIJ0
Position
complement(2965998..2966963)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDVDSGEISRAKTYSGLDYPSLEAVVRVYLDEHQVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDRRWVSLPGEGGHVDFAPNSEEEDIILEVLRAE
IGHVSAERVLSGPGLVNLYRAIVKADGRLPENLRPKDITERALADSCTDSRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGAFEDKGRFKAYVQDIPVYLIV
HDNPGLLGAGAHLRQTLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggggatgtgggcggcaccaacgcgcgtcttgctctgtgc
gatgtcgacagcggggagatctcgcgagctaaaacctattccggccttgattatcccagc
ctggaagccgtggtgcgggtttatctcgatgagcatcaggtgagcgtggaagatggctgc
attgctatcgcctgtccgatcaccggcgactgggtcgcgatgactaaccatacctgggcg
ttttctattgcggagatgaaaaagaatcttggcttcagccatctggaaatcatcaatgat
tttaccgcggtatcgatggcgatcccgatgctgaaaaaagagcatttgattcagtttggc
ggggcggaaccggtggagggcaaacccatcgcggtgtacggcgcgggcaccggacttggc
gtggcgcatctggtccatgtcgaccggcgctgggtgagtctgccgggcgagggcggacac
gtggattttgcgccgaacagcgaagaggaagatattattctggaggtgctgcgcgccgaa
atcggccacgtttccgccgagcgggtgctttccggtcccggcctggtgaacctgtaccgc
gcgatagtcaaagcggatggtcgtctgccggaaaatctgcggccgaaagatatcaccgaa
cgcgcgctggcggacagttgcaccgacagccgccgcgcgctgtcgctgttttgtgtgatc
atggggcgctttggcggcaacctggcgttgacgctgggcacgtttggcggcgtgtacatt
gccggcggcatcgtgccgcgcttccttgagttcttcaaagcttccggtttccgcggcgcg
tttgaagacaaaggccgttttaaagcttacgtgcaggatatcccggtctatttgatcgtc
cacgataatccggggctgcttggcgcgggcgcgcatctgcgccagaccttagggcagatt
ctgtag

DBGET integrated database retrieval system