KEGG   Citrobacter rodentium: ROD_32691Help
Entry
ROD_32691         CDS       T01145                                 

Gene name
cysQ
Definition
cysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cro  Citrobacter rodentium
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ROD_32691 (cysQ)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ROD_32691 (cysQ)
Transfer RNA biogenesis [BR:cro03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ROD_32691 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3449437..3450177
Genome map
AA seq 246 aa AA seqDB search
MLEQVCQLARNAGDAIMQVYDGAKPMEIASKLDDSPVTAADIAAHAVIVEGLKTLTPDIP
ILSEEDPPAWAVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDKGKPVLGVVYAPVM
KVMYSAAEGKAWKEECGVRKPIQVRDARPPLVVISRSHADNELKEYLQQLGEHQTTAIGS
SLKFCLVAEGQAQLYPRFGPTSIWDTAAGHAVAAAAGAHVHDWQGKTLDYTPRESFLNPG
FRVSIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtctgtcagcttgcacggaacgcgggcgatgccattatgcaggtttat
gatggagcgaaaccgatggagatcgccagtaagctggatgattctcccgtcaccgcagcg
gacattgctgctcatgccgttatcgtcgaagggttgaaaacgctgactccggatataccg
attctgtcggaagaagatccgccggcctgggctgtgcgtcagcactggcagcgctactgg
ctggtggacccgctggacggcaccaaagagtttatcaagcgtaacggcgaattcaccgtc
aatatcgcgctgattgataaaggcaagccggtactcggcgtggtctacgcgccggtgatg
aaagtgatgtacagcgccgccgaaggcaaagcctggaaagaagagtgcggcgtgcgtaaa
cccattcaggtgcgtgacgcccgcccgccgctggtggtgattagccgttcgcatgcggat
aacgaactgaaagagtatctgcagcagctgggcgaacaccagactaccgccattggctcc
tcgctgaagttttgtctggtggcggaaggccaggcccagctttacccgcgcttcgggccg
accagcatctgggataccgccgcaggtcatgcggttgccgccgccgccggggcgcacgtt
cacgactggcaggggaaaacgctggactatacgccgcgtgaatcgttccttaaccccggc
ttccgcgtctctatttactga

DBGET integrated database retrieval system