KEGG   Citrobacter rodentium: ROD_34571Help
Entry
ROD_34571         CDS       T01145                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cro  Citrobacter rodentium
Pathway
cro00010  Glycolysis / Gluconeogenesis
cro00620  Pyruvate metabolism
cro00640  Propanoate metabolism
cro00680  Methane metabolism
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01120  Microbial metabolism in diverse environments
cro01130  Biosynthesis of antibiotics
cro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROD_34571 (acs)
   00620 Pyruvate metabolism
    ROD_34571 (acs)
   00640 Propanoate metabolism
    ROD_34571 (acs)
  Energy metabolism
   00680 Methane metabolism
    ROD_34571 (acs)
Enzymes [BR:cro01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ROD_34571 (acs)
Lipid biosynthesis proteins [BR:cro01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ROD_34571 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBG90171
UniProt: D2TPY4
Position
complement(3647504..3649462)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHAIPASIADRCLINPQQYEAQYQQSINDPDTFWGEQGKILDWIKPYTRVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLAENGDRTAIIWEGDDASQSKHISYRQLHRDVCRF
ANALQDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS
KLVITADEGVRAGRTIPLKKNVDDALKNPNVNSIEHVIVLKRTGGPVDWSEGRDLWWNEV
TEKAHDQHEPVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKATEGTSRASLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHSIKGQAIYAYVTLNHGEDPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacataaacacgctattcccgccagtattgcggaccgttgcctgattaac
ccgcagcagtatgaggcgcaatatcaacaatcaattaacgatcctgataccttctggggc
gaacagggaaaaattctcgactggataaaaccgtacactcgcgtcaagaacacctccttt
gcgccgggcaatgtgtccattaaatggtacgaagacggcacgctaaacctagcggcaaac
tgccttgaccgccacctcgcggaaaacggcgatcgcaccgccatcatctgggaaggcgac
gacgcttcgcagagcaaacacatcagctaccgccagttgcaccgcgacgtctgccgcttt
gccaacgccctgcaagacttaggcattaaaaaaggcgacgtggtggcgatttatatgccg
atggtgccggaagcggccgttgccatgctggcctgcgcgcgcatcggtgcggtgcattcg
gtgatcttcggcggcttctcgccggaagcggtcgccgggcgtattatcgactccagttca
aagctggtgatcaccgccgatgaaggcgtgcgcgccggacgcaccatcccgctgaagaaa
aacgtcgacgacgcgctgaaaaacccgaacgtcaacagtattgagcacgtgattgtgctg
aagcgcaccggcggccctgtcgactggagcgaaggccgcgacctgtggtggaacgaggtg
actgaaaaggcccacgaccagcatgagccggttgaaatgaatgcggaagatccgctgttt
atcctctatacctctggctccaccggcaaaccgaaaggcgtactgcataccaccggcggt
tatctggtgtatgccgccaccacctttaagtacgtttttgactatcatccgggcgacatt
tactggtgcaccgccgacgtgggctgggtaaccgggcacagctatctgctgtacggcccg
ctggcctgcggcgcgacgacgctgatgtttgaaggggtgccaaactggccgactccggcg
cgcatggcgcaggtggtcgataagcaccaggtgaatattctgtataccgcgccgaccgcg
atccgcgcgctgatggcggaaggcgataaggcgaccgaaggcaccagccgcgcctcgctg
cgcattctcggctccgtcggcgagccgatcaacccggaagcgtgggagtggtactggaag
aagatcggcaatgaaaagtgcccggtggtggatacctggtggcagaccgaaaccggcggc
ttcatgatcactccgctgcccggcgcaacggagctgaaagccggttccgcaacgcgtccg
ttcttcggcgtgcagcctgcgctggtggacaacgaaggcaatccgcaggaaggggcgacc
gagggcaatctggtgatcaccgactcctggcctggccaggcgcgtacgctgtttggcgat
cacgaacgcttcgagcagacctacttctccacctttaagaatatgtacttcagcggcgac
ggcgcgcggcgtgacgaagacggttactactggatcaccggtcgcgtggacgacgtgctg
aacgtctctggccaccgtctgggcacggcagaaattgaatcggcgctggtggcgcatccg
aagatcgccgaagccgcggtggtcggtattccgcatagcatcaaaggccaggcgatttac
gcctacgtgaccctgaatcatggcgaagacccctcacccgagctgtacgcggaagtgcgc
aactgggtgcgcaaagagattggcccgctggcgacgccggacgtgctgcactggaccgac
tcactgccgaaaacccgttccggcaaaattatgcgccgtattttgcgcaagatcgcggcg
ggcgataccagcaatctgggcgacacctcgaccctcgccgatccgggcgtggtagagaag
ctgctcgaagagaagcaggctatcgcgatgccgtcataa

DBGET integrated database retrieval system