KEGG   Citrobacter rodentium: ROD_37431Help
Entry
ROD_37431         CDS       T01145                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cro  Citrobacter rodentium
Pathway
cro00620  Pyruvate metabolism
cro00630  Glyoxylate and dicarboxylate metabolism
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01120  Microbial metabolism in diverse environments
cro01200  Carbon metabolism
Module
cro_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROD_37431 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    ROD_37431 (aceB)
Enzymes [BR:cro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ROD_37431 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CBG90448
UniProt: D2TSQ7
Position
complement(3926827..3928428)
Genome map
AA seq 533 aa AA seqDB search
MNQQATTTDELTFTRPSGEAEKQILTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDIDN
GKLPDFISETASIRNGDWTIRGIPEDLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPEWSKVIDGHINLRDAVNGTISYTNEAGKIYQLKPDPALLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNHKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFSLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLAKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNEALGENKNQLFVTREEDAPIAAEQLLAPCEGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALFR
QMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaggcgaccactaccgatgaattgacctttaccaggcccagcggtgaggcg
gaaaagcaaattctgacggcggaagcagtggagtttctcacggaactggtgacgcgtttt
acgcctaagcgtaacaaactgctcgccgcacgcattcagcagcagcaggatatcgacaac
ggcaagctgccggattttatttcggaaactgcttccattcgcaatggtgactggacgatt
cgcggtattccagaagatttacaggatcgtcgcgttgagatcaccgggccagtggagcgc
aagatggtgatcaacgccctgaatgccaacgtgaaggtatttatggccgattttgaagac
tcactggcgccggaatggagcaaagtgatcgacggacatatcaacctgcgcgatgcggtg
aatggcaccatcagttacaccaacgaagccggtaagatttaccagcttaagccagatccg
gcgctgctgatttgtcgcgtgcgcggcctgcatctgccggaaaaacatgtcacctggcgc
ggtgaggcgatcccgggcagcctgttcgattttgcgctctatttctttcacaatcacaaa
gcgctgctggccaaaggtagcggcccttatttctatctgccgaaaacccaggcctggcag
gaagcggcctggtggagcgaagtgttcagctatgccgaagatcgcttcagtctgccgcgc
ggcacaatcaaagcgaccctgctgattgaaactctgcccgccgtcttccagatggatgaa
atactccacgccctgcgcgaccacatcgtggggctgaactgcggtcgttgggactacatc
tttagctatatcaaaacattgaaaaatcatccggaccgcgtcctgcctgaccgtcaggtg
gtgacaatggataagccgttcctcagcgcctattcgcgcctgctgattaagacctgccac
aagcgcggcgcattcgcgatgggcggcatggcggcgtttattccaagcaaagatgccgag
cgaaataatcaggtgctcgccaaagtaaaagcggataaagcgctggaggccaacaacggt
cacgatggcacctggattgcccatccggggctggcggataccgcgatggcggtgtttaac
gaggcgctgggcgagaacaaaaaccagcttttcgtcacccgcgaggaggacgcgccgatc
gccgcagagcaactgctggcgccgtgtgaaggtgagcgtaccgaagagggaatgcgcgcc
aatattcgcgttgcggtgcagtacatcgaagcatggatctccggtaacggctgtgtaccg
atttatggcctgatggaagatgcggcgaccgcggaaatttcccgcacctctatctggcag
tggatccaccatgagaaaacactcagcaacggcaaaccggtaaccaaagccctgttccgt
caaatgttggccgaagagatgcgggtgatccaggacgaactgggcgagcaccgctacagc
agcggccgtttcgatgacgctgcgcgcctgatggaacagatcaccacttcagatgactta
atcgatttcctgacgctgccgggctaccgcctgctggcgtaa

DBGET integrated database retrieval system