KEGG   Citrobacter rodentium: ROD_38221Help
Entry
ROD_38221         CDS       T01145                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cro  Citrobacter rodentium
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cro00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4028102..4029610
Genome map
AA seq 502 aa AA seqDB search
MTDKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKAGWVEHDPMEIWATQSST
LVEVLAKADIRSDQIAAIGITNQRETTIVWERETGKPIYNAIVWQCRRTADICEHLKRDG
MEEYVRSTTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHTLDWDDKMLDALDIPRAMLPEVSRSSEVYGQTNIGGKGGTRIPI
SGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFPTKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRALAWEEHDA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaaaaatatatcgttgcgctcgatcagggcaccaccagctcccgcgccgtc
gtgatggatcacgatgcgaatatcgtgagcgtttcccaacgcgaatttgagcagatctac
ccgaaggcgggttgggtagaacatgacccgatggaaatctgggcaacgcaaagctcgacg
ctggtggaagtgctggcaaaagcggacatccgttccgatcagattgcagctatcggtatc
accaaccagcgcgaaacgaccatcgtctgggagcgggaaaccggtaagccgatttacaac
gccatcgtctggcaatgtcgtcgcaccgcagacatctgtgagcatttaaaacgcgacggc
atggaagagtatgtgcgcagcacaaccggcctggtgattgacccctacttctccggcacc
aaagtgaagtggatcctcgaccacgtcgaaggctcccgcgagcgagcgcgtcgcggcgaa
ctgctgttcggcaccgtagatacctggcttatctggaaaatgacccaggggcgcgtacac
gtcacggattacaccaacgcctcgcgcaccatgctgttcaatatccacacgctggactgg
gacgacaagatgctggatgcgctggatattccgcgcgccatgctgccggaggtgagccgt
tcttctgaagtgtatggtcaaaccaacatcggcgggaaaggcggcacgcgtattcctatc
tccggtattgccggcgaccagcaggcggcgctattcggccagctgtgcgtcaaggaaggg
atggcgaagaacacctacggcaccggctgctttatgctgatgaacaccggggagaaagcg
gtcaagtccgaaaacggacttttgaccaccatcgcctgcggcccgaccggggaagtgaac
tacgcactggagggcgcggtgtttatggccggcgcgtctattcagtggctgcgtgatgag
atgaagctgatcagcgacgcgtttgactccgaatatttccccaccaaagtgaaagatacc
aacggcgtgtatgtggttccggcctttaccggcctcggcgcaccgtactgggacccgtat
gcccgcggcgccatcttcggcctgacccgtggcgtcaattccaaccacattatccgcgcg
acgctggaatccatcgcttatcagacccgcgacgtgctggaagcgatgcaagcggactcc
ggcattcgcctgcacgctctgcgcgtggatggcggcgcggttgccaataacttcctgatg
cagttccagtctgacattctcggcacgcgcgtcgagcgcccggaagtacgcgaagtcacc
gcgctgggtgcggcgtacctggcgggactggcggtcggttactggcagaaccttgatgag
ctgcaggaaaaagcggtgattgagcgtgaattccgtcccggtatcgaaaccaccgagcgt
aactaccgttacagcggctggaagaaggcggtcaaacgcgcgctggcatgggaagaacac
gacgcgtaa

DBGET integrated database retrieval system