KEGG   Citrobacter rodentium: ROD_38281Help
Entry
ROD_38281         CDS       T01145                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cro  Citrobacter rodentium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROD_38281 (tpiA)
   01230 Biosynthesis of amino acids
    ROD_38281 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROD_38281 (tpiA)
   00051 Fructose and mannose metabolism
    ROD_38281 (tpiA)
   00562 Inositol phosphate metabolism
    ROD_38281 (tpiA)
Enzymes [BR:cro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ROD_38281 (tpiA)
Exosome [BR:cro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ROD_38281 (tpiA)
  Exosomal proteins of bladder cancer cells
   ROD_38281 (tpiA)
  Exosomal proteins of melanoma cells
   ROD_38281 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4033272..4034039
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVSNLRKELAGVAGCAVAIAPPEMYIDLAKHAAAGSHII
LGAQNVDLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGQTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccatatggtaaac
gagctggtatcgaacctgcgtaaagagctggcgggcgttgctggctgcgcggtggctatc
gctccgccggaaatgtacatcgacctggcgaagcacgctgcggccggtagccacattatc
ctcggcgcgcagaacgttgacctgaacctgtccggcgctttcaccggtgaaacctctgcg
gaaatgctgaaagatatcggcgcgcagtacatcatcatcggccactctgagcgtcgtact
tatcacaaagagtctgacgaactgatcgcgaaaaaatttgccgtgctgaaagagcagggc
ctgaccccggttctgtgcatcggtgaaaccgaagcggaaaacgaagcgggccagaccgaa
gaagtgtgtgcccgtcagatcgacgccgtgctgaaaacgcagggcgctgccgcctttgaa
ggcgcggtaatcgcttacgaaccggtctgggcgatcggtaccggtaaatccgcgacccca
gcgcaggcgcaggctgttcacaaattcatccgtgaccacatcgccaaagcggacgcgaaa
atcgctgaacaggttatcatccagtacggcggctccgtaaacgcctccaacgcggctgaa
ctgttcgctcagccggacatcgacggcgcgctggttggcggcgcttcgctgaaagccgat
gccttcgcggtaattgtgaaagcggcagaagcagccaaacaggcttaa

DBGET integrated database retrieval system