KEGG   Citrobacter rodentium: ROD_39091Help
Entry
ROD_39091         CDS       T01145                                 

Gene name
fadB
Definition
fatty oxidation complex subunit alpha [includes: enoyl-CoA hydratase; delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase; 3-hydroxyacyl-CoA dehydrogenase; 3 hydroxybutyryl-CoA epimerase] (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
cro  Citrobacter rodentium
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ROD_39091 (fadB)
   01212 Fatty acid metabolism
    ROD_39091 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ROD_39091 (fadB)
   00650 Butanoate metabolism
    ROD_39091 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ROD_39091 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ROD_39091 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ROD_39091 (fadB)
   00310 Lysine degradation
    ROD_39091 (fadB)
   00380 Tryptophan metabolism
    ROD_39091 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ROD_39091 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ROD_39091 (fadB)
   00281 Geraniol degradation
    ROD_39091 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    ROD_39091 (fadB)
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ROD_39091 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ROD_39091 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ROD_39091 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     ROD_39091 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4128224..4130413
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALDVLEKQTDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLSAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGAEQALK
IGLVDGVVKPEKLVEGALAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQFVK
GKAKKLTKDVQTPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLTLGMNEAAKLL
NKQLERGKVDGLKMAGVISSIHPTLDYAGFERVDVVVEAVVENPKVKKAVLAETEEKVRP
DTVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASRMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDATVESLLADVSNAKHDFSDEEIIARMMIPMVNEVARCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSARYFDMAQQYQHLGPLYAVPEGLRNKARHNEPYYPPVEPA
RPVGSLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgcccctggctcggtcaataaactcgacactgcgaccgtcgccagcctcggc
caggcgctggatgtactggaaaagcaaacagatttaaaagggctgctgctgcgttcgaat
aaagcggcctttattgtcggtgcggatatcaccgaattcctttcgctgttccttgttcct
gaagaacagttaagccagtggctgcatttcgccaacagcgtctttaaccgtctggaagat
ctgccggtgccgaccctctccgccgtcaacggctatgcgttgggcggcggctgcgaatgc
gtgctggcgaccgactaccgtctggcgacgccggatctgcgcatcggcctgccggaaacg
aagctggggatcatgcccggcttcggcggttccgtacgtatgccgcgtatgctcggcgcg
gacagcgcgctggaaattattgccgccggtaaagacgtcggcgcggagcaggcgctgaaa
atcggcctggtcgacggcgtggtgaagcccgaaaaactggttgaaggcgcgctggcggtt
ttacgccaggcgattaacggcgatctggactggaaagccaaacgccagccgaagctggag
ccgctgaagctcagtaagattgaagccacgatgagttttaccatcgccaaaggcatggtc
gcgcagacggcgggcaagcattacccggcccccatcaccgcggtaaaaaccattgaggcg
gcagcgcgttttggtcgtgaagaagcgctgaatctggaaaacaaaagctttgttccgctg
gcgcacaccaatgaagcccgcgcgctggtcggtattttcctgaacgatcagtttgttaaa
ggcaaggcgaagaagctgaccaaagatgttcagacgccgaagcaggctgccgtactgggc
gccggtattatgggcggcggtatcgcttatcagtcggcgtggaaaggcgtgccggtgatc
atgaaggatatcaacgacaaatcgctgacgctggggatgaacgaagccgccaagctgctg
aataaacagcttgaacgcggtaaggttgacggcctgaagatggcgggcgtgatttcgtcg
attcatccgaccctcgactacgccggttttgaacgcgtggatgtggttgtcgaagcggtg
gtcgagaatccgaaagtgaaaaaagcggtactggcggagaccgaagaaaaagtccgtccg
gataccgtactggcctcgaacacctcgaccattcccattagcgaactggcaagcgtgctg
aaacgcccggaaaacttctgtgggatgcacttttttaatccggttcaccggatgccgctg
gttgaaattattcgcggagagaaaagctcggatgaaaccatcgctaaggtggtcgcctgg
gcaagccgtatgggtaaaacgccgatcgtggtcaacgactgccccggcttctttgttaac
cgcgtgctgttcccttacttcgctggcttcagccagctgctgcgcgacggcgcggacttc
cgcaaaatcgacaaggtgatggaaaagcagtttggctggccgatgggcccggcgtacctg
ctggacgtggtgggcattgataccgcgcatcatgctcaggcggtaatggccgctggcttc
ccacagcgaatgcagaaagattatcgcgacgcgatcgacgccctgtttgacgccaaccgt
tttggccagaaaaacggcctcggattctggcgttataaagaagacagcaaaggcaagccg
aagaaagaagaagacgctaccgtagagagcctgctggccgacgtcagcaatgcgaagcat
gacttcagcgatgaagagatcatcgcccgcatgatgatcccgatggtcaacgaagtggcg
cgctgtctcgaagaaggcattatcgccagcccggcggaagccgatatggcgctggtctac
ggcctgggcttcccgccgttccacggcggcgcgttccgctggctggatacgctcggcagc
gccagatatttcgatatggcgcaacagtaccagcacctcggcccgctgtatgccgtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcccccggttgagcctgcc
cgtccggttggttccctgaaaacggcttaa

DBGET integrated database retrieval system