KEGG   Citrobacter rodentium: ROD_39871Help
Entry
ROD_39871         CDS       T01145                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cro  Citrobacter rodentium
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ROD_39871 (rbsK)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ROD_39871 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4220667..4221596)
Genome map
AA seq 309 aa AA seqDB search
MKTAGKLVVLGSINADHILNLETFPAPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDAIGNNIRQQLTSDNIDVAPVSVIAGEATGVALIFVNGAGENVIGIHAGANAAL
SPALVDAQRERIAQASALLMQLESPIESVLAAAKIARQNNTRVVLNPAPARALSDELLAL
VDIITPNETEAEKLTGVRVENDDDAVKAAQALHDKGIDTVLITLGSRGVWASVKGEGRRV
PGFKVEAVDTIAAGDTFNGALITGLLEDMPLPDAIRFAHAAAAIAVTRKGAQPSVPWREE
IEAFLGQQR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggcaaacttgtcgttctcggcagtatcaacgccgaccatatccttaat
ctcgagacatttcctgcacccggtgaaaccgtcaccggtaatcactatcaggtcgctttt
ggtggtaaaggcgcgaatcaggcagtggctgcgggacgcagcggggcaaacattgcgttt
attgcctgtacgggtgatgacgccatcggaaacaatattcgtcaacagctgacgagcgac
aatatcgatgttgcacccgtcagcgttattgcgggtgaagccaccggcgtggcgctcatt
tttgtgaacggcgcaggtgagaacgttatcggcattcatgccggggcaaacgccgcgctt
tccccggcgttagttgacgcgcagcgtgaacgcatcgctcaggcttccgcactgctgatg
cagctggagtcgccgatcgaaagcgtactcgccgcggcgaaaatcgcccggcaaaataac
acgcgcgtggtgctgaatccggcgccggcgcgggcgctttctgacgagctgctggcgctg
gtggatatcattacccctaatgaaacggaagcggaaaagctgaccggggtccgcgtggaa
aatgacgatgacgccgtgaaagccgcgcaggcgttgcatgataaaggcatcgatacggtg
ctgatcaccctgggtagccggggcgtctgggccagcgtgaaaggtgaaggacgtcgcgta
cctggctttaaggtcgaggctgtcgataccatcgcagcgggagatacctttaacggcgcg
ctgattaccgggctgctggaagatatgccgctgcctgatgcgattcgtttcgcccatgct
gccgcggctatcgctgttacccgtaaaggtgctcagccttctgtgccgtggcgtgaagag
atcgaggcgtttttaggtcagcagaggtaa

DBGET integrated database retrieval system