KEGG   Citrobacter rodentium: ROD_42761Help
Entry
ROD_42761         CDS       T01145                                 

Gene name
bcsZ
Definition
(GenBank) endo-1,4-beta-glucanase (cellulase) (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
cro  Citrobacter rodentium
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4515792..4516898
Genome map
AA seq 368 aa AA seqDB search
MNALRSGIAAVLMLAALSAQAACSWPAWDQFKKDYISQEGRVIDPSDARKITTSEGQSYA
MFFALAANDRQAFDRLLAWSENNLAQGSLKEHLPAWLWGQKDPDNWSVLDSNSASDGDIW
IAWSLLEAGRLWQEPRYTDIGKALLKRIASEEVVTVPGLGSMLLPGKIGFAEENSWRFNP
SYLPPQLAQYFTRFGAPWTTLRETNQRLLSETAPKGFSPDWVRYEKNKGWQLKPEKTLVS
SYDAIRVYLWVGMMHDRDPQKARLLAKFKPMATLTAKNGLPPEKVDVASGKAQGNGPVGF
SASLLPFLQDRDAQAVQRQSVADHFPGSDAYYSYVLTLFGQGWDQHRYRFAANGELLPDW
GQECASSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgttgcgtagtggaatcgccgctgtcctgatgctggccgcgctgagcgcccag
gcggcctgtagctggcctgcctgggatcaattcaaaaaggattacatcagccaggaaggg
cgggtgattgatcccagcgacgcgcggaaaatcaccacgtccgaggggcaaagctacgcc
atgttctttgccctcgccgctaacgacaggcaggcgtttgataggctgctggcctggagt
gaaaacaacctggcgcaaggttccctgaaggaacatctgcccgcctggctgtgggggcaa
aaagatccggataactggagcgtgctggacagtaattccgcctccgacggcgatatctgg
atcgcctggtcgctgctggaagccgggcgtttatggcaggagccgcgctataccgacatc
ggcaaagcgctgctgaaacggattgccagcgaggaagtggtgacggtgccggggctgggg
tcgatgctgctacccggcaaaatcggctttgccgaagagaacagctggcgctttaacccg
agctatctgccgccgcagctggcgcagtatttcacccgtttcggcgcgccgtggaccacc
ctgcgcgaaacgaatcaacgtctgctgtcagaaaccgcgccgaaaggcttctcgccggac
tgggtgcgttacgagaaaaacaagggctggcagctgaagccggagaaaacgctggtcagc
agctatgacgccattcgcgtttacctgtgggtcggcatgatgcatgaccgcgatccgcaa
aaagcgcggctgctggcgaaattcaaaccgatggcgactctcaccgctaaaaacggcctt
ccgccggagaaagtggacgtcgccagcggtaaagcgcagggcaacggtccggtaggattt
tccgcctctttgctgcctttcctgcaagaccgcgacgcgcaggcggtgcagcggcagagc
gtggcggaccattttcccggtagcgacgcctattacagttacgtgctgacactcttcggg
cagggctgggatcagcatcgttaccgcttcgccgccaacggcgagttactacctgactgg
ggccaggaatgcgcaagttcacattaa

DBGET integrated database retrieval system