KEGG   Citrobacter rodentium: ROD_42761Help
Entry
ROD_42761         CDS       T01145                                 

Gene name
bcsZ
Definition
endo-1,4-beta-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cro  Citrobacter rodentium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ROD_42761 (bcsZ)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ROD_42761 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4515792..4516898
Genome map
AA seq 368 aa AA seqDB search
MNALRSGIAAVLMLAALSAQAACSWPAWDQFKKDYISQEGRVIDPSDARKITTSEGQSYA
MFFALAANDRQAFDRLLAWSENNLAQGSLKEHLPAWLWGQKDPDNWSVLDSNSASDGDIW
IAWSLLEAGRLWQEPRYTDIGKALLKRIASEEVVTVPGLGSMLLPGKIGFAEENSWRFNP
SYLPPQLAQYFTRFGAPWTTLRETNQRLLSETAPKGFSPDWVRYEKNKGWQLKPEKTLVS
SYDAIRVYLWVGMMHDRDPQKARLLAKFKPMATLTAKNGLPPEKVDVASGKAQGNGPVGF
SASLLPFLQDRDAQAVQRQSVADHFPGSDAYYSYVLTLFGQGWDQHRYRFAANGELLPDW
GQECASSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgttgcgtagtggaatcgccgctgtcctgatgctggccgcgctgagcgcccag
gcggcctgtagctggcctgcctgggatcaattcaaaaaggattacatcagccaggaaggg
cgggtgattgatcccagcgacgcgcggaaaatcaccacgtccgaggggcaaagctacgcc
atgttctttgccctcgccgctaacgacaggcaggcgtttgataggctgctggcctggagt
gaaaacaacctggcgcaaggttccctgaaggaacatctgcccgcctggctgtgggggcaa
aaagatccggataactggagcgtgctggacagtaattccgcctccgacggcgatatctgg
atcgcctggtcgctgctggaagccgggcgtttatggcaggagccgcgctataccgacatc
ggcaaagcgctgctgaaacggattgccagcgaggaagtggtgacggtgccggggctgggg
tcgatgctgctacccggcaaaatcggctttgccgaagagaacagctggcgctttaacccg
agctatctgccgccgcagctggcgcagtatttcacccgtttcggcgcgccgtggaccacc
ctgcgcgaaacgaatcaacgtctgctgtcagaaaccgcgccgaaaggcttctcgccggac
tgggtgcgttacgagaaaaacaagggctggcagctgaagccggagaaaacgctggtcagc
agctatgacgccattcgcgtttacctgtgggtcggcatgatgcatgaccgcgatccgcaa
aaagcgcggctgctggcgaaattcaaaccgatggcgactctcaccgctaaaaacggcctt
ccgccggagaaagtggacgtcgccagcggtaaagcgcagggcaacggtccggtaggattt
tccgcctctttgctgcctttcctgcaagaccgcgacgcgcaggcggtgcagcggcagagc
gtggcggaccattttcccggtagcgacgcctattacagttacgtgctgacactcttcggg
cagggctgggatcagcatcgttaccgcttcgccgccaacggcgagttactacctgactgg
ggccaggaatgcgcaagttcacattaa

DBGET integrated database retrieval system